BLASTX nr result
ID: Angelica27_contig00021999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00021999 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM84483.1 hypothetical protein DCAR_028095 [Daucus carota subsp... 68 1e-10 XP_017222986.1 PREDICTED: splicing factor U2af large subunit B-l... 68 1e-10 >KZM84483.1 hypothetical protein DCAR_028095 [Daucus carota subsp. sativus] Length = 506 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 141 SRHNGDGDADQGASSPYDVFEDRSSHHQKQKYN 239 +R+N DGDADQG SSPYDVFEDRSSHHQKQKYN Sbjct: 6 NRYNADGDADQGGSSPYDVFEDRSSHHQKQKYN 38 >XP_017222986.1 PREDICTED: splicing factor U2af large subunit B-like isoform X1 [Daucus carota subsp. sativus] Length = 540 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 141 SRHNGDGDADQGASSPYDVFEDRSSHHQKQKYN 239 +R+N DGDADQG SSPYDVFEDRSSHHQKQKYN Sbjct: 6 NRYNADGDADQGGSSPYDVFEDRSSHHQKQKYN 38