BLASTX nr result
ID: Angelica27_contig00020938
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00020938 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215391.1 PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylo... 53 9e-06 >XP_017215391.1 PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase MGP4-like [Daucus carota subsp. sativus] KZM88158.1 hypothetical protein DCAR_025233 [Daucus carota subsp. sativus] Length = 359 Score = 52.8 bits (125), Expect = 9e-06 Identities = 27/37 (72%), Positives = 29/37 (78%), Gaps = 2/37 (5%) Frame = -1 Query: 203 MSTSLHQRTLPTTLTDPYPKSPKSI--SQKPGSFLTR 99 MS SL+QR P TL DPYP+SPKS SQKPGSFLTR Sbjct: 1 MSASLYQRQPPITLADPYPESPKSTINSQKPGSFLTR 37