BLASTX nr result
ID: Angelica27_contig00020906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00020906 (225 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219801.1 PREDICTED: probable plastidic glucose transporter... 60 7e-09 KZM87565.1 hypothetical protein DCAR_024693 [Daucus carota subsp... 60 7e-09 XP_017219797.1 PREDICTED: probable plastidic glucose transporter... 60 7e-09 >XP_017219801.1 PREDICTED: probable plastidic glucose transporter 2 isoform X2 [Daucus carota subsp. sativus] Length = 404 Score = 60.1 bits (144), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 135 MWAHLHSSASTHKRMLLRDNSTTPDIEENS 224 MWAHLH SASTHKRMLL+DNS +PDIEENS Sbjct: 1 MWAHLHGSASTHKRMLLKDNSVSPDIEENS 30 >KZM87565.1 hypothetical protein DCAR_024693 [Daucus carota subsp. sativus] Length = 483 Score = 60.1 bits (144), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 135 MWAHLHSSASTHKRMLLRDNSTTPDIEENS 224 MWAHLH SASTHKRMLL+DNS +PDIEENS Sbjct: 1 MWAHLHGSASTHKRMLLKDNSVSPDIEENS 30 >XP_017219797.1 PREDICTED: probable plastidic glucose transporter 2 isoform X1 [Daucus carota subsp. sativus] XP_017219799.1 PREDICTED: probable plastidic glucose transporter 2 isoform X1 [Daucus carota subsp. sativus] XP_017219800.1 PREDICTED: probable plastidic glucose transporter 2 isoform X1 [Daucus carota subsp. sativus] Length = 492 Score = 60.1 bits (144), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 135 MWAHLHSSASTHKRMLLRDNSTTPDIEENS 224 MWAHLH SASTHKRMLL+DNS +PDIEENS Sbjct: 1 MWAHLHGSASTHKRMLLKDNSVSPDIEENS 30