BLASTX nr result
ID: Angelica27_contig00020711
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00020711 (542 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017248072.1 PREDICTED: carbamoyl-phosphate synthase small cha... 67 1e-09 XP_017248070.1 PREDICTED: carbamoyl-phosphate synthase small cha... 67 1e-09 JAT57771.1 Carbamoyl-phosphate synthase small chain [Anthurium a... 60 2e-07 XP_012829965.1 PREDICTED: carbamoyl-phosphate synthase small cha... 60 3e-07 XP_019074703.1 PREDICTED: anthranilate synthase 02 isoform X1 [V... 59 6e-07 CBI37602.3 unnamed protein product, partial [Vitis vinifera] 59 7e-07 NP_001268181.1 anthranilate synthase 02 [Vitis vinifera] ACY2965... 59 7e-07 GAV58979.1 GATase domain-containing protein/CPSase_sm_chain doma... 58 9e-07 CDP12786.1 unnamed protein product [Coffea canephora] 58 1e-06 XP_006353537.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_015070502.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_004235978.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_016453893.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_009610081.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_006353536.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_019230362.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_009793979.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_006345169.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_016453892.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 XP_009610080.1 PREDICTED: carbamoyl-phosphate synthase small cha... 58 1e-06 >XP_017248072.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic isoform X2 [Daucus carota subsp. sativus] Length = 431 Score = 66.6 bits (161), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEKQNL 452 YHPEASPGPHDSDPVFEEFVKLMK+EKQNL Sbjct: 402 YHPEASPGPHDSDPVFEEFVKLMKREKQNL 431 >XP_017248070.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic isoform X1 [Daucus carota subsp. sativus] XP_017248071.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic isoform X1 [Daucus carota subsp. sativus] Length = 432 Score = 66.6 bits (161), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEKQNL 452 YHPEASPGPHDSDPVFEEFVKLMK+EKQNL Sbjct: 403 YHPEASPGPHDSDPVFEEFVKLMKREKQNL 432 >JAT57771.1 Carbamoyl-phosphate synthase small chain [Anthurium amnicola] Length = 452 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEKQNL 452 YHPEASPGPHDSDP F EF+KLMK EKQN+ Sbjct: 423 YHPEASPGPHDSDPAFGEFIKLMKLEKQNI 452 >XP_012829965.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic [Erythranthe guttata] EYU43489.1 hypothetical protein MIMGU_mgv1a006980mg [Erythranthe guttata] Length = 424 Score = 59.7 bits (143), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEKQ 458 YHPEASPGPHDSDPVF EF++LMKQEKQ Sbjct: 395 YHPEASPGPHDSDPVFGEFIQLMKQEKQ 422 >XP_019074703.1 PREDICTED: anthranilate synthase 02 isoform X1 [Vitis vinifera] Length = 350 Score = 58.5 bits (140), Expect = 6e-07 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEKQN 455 YHPEASPGPHDSDP F EF++LMKQ KQN Sbjct: 321 YHPEASPGPHDSDPAFREFIQLMKQVKQN 349 >CBI37602.3 unnamed protein product, partial [Vitis vinifera] Length = 426 Score = 58.5 bits (140), Expect = 7e-07 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEKQN 455 YHPEASPGPHDSDP F EF++LMKQ KQN Sbjct: 397 YHPEASPGPHDSDPAFREFIQLMKQVKQN 425 >NP_001268181.1 anthranilate synthase 02 [Vitis vinifera] ACY29659.1 anthranilate synthase 02 [Vitis vinifera] Length = 426 Score = 58.5 bits (140), Expect = 7e-07 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEKQN 455 YHPEASPGPHDSDP F EF++LMKQ KQN Sbjct: 397 YHPEASPGPHDSDPAFREFIQLMKQVKQN 425 >GAV58979.1 GATase domain-containing protein/CPSase_sm_chain domain-containing protein [Cephalotus follicularis] Length = 429 Score = 58.2 bits (139), Expect = 9e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEKQN 455 YHPEASPGPHDSD VFEEFVKLMK KQN Sbjct: 400 YHPEASPGPHDSDCVFEEFVKLMKSVKQN 428 >CDP12786.1 unnamed protein product [Coffea canephora] Length = 423 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 394 YHPEASPGPHDSDPVFGEFIQLMKQEK 420 >XP_006353537.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 425 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 396 YHPEASPGPHDSDPVFGEFIQLMKQEK 422 >XP_015070502.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic [Solanum pennellii] Length = 426 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 397 YHPEASPGPHDSDPVFGEFIQLMKQEK 423 >XP_004235978.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic [Solanum lycopersicum] Length = 426 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 397 YHPEASPGPHDSDPVFGEFIQLMKQEK 423 >XP_016453893.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic-like isoform X2 [Nicotiana tabacum] Length = 428 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 399 YHPEASPGPHDSDPVFGEFIQLMKQEK 425 >XP_009610081.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic isoform X3 [Nicotiana tomentosiformis] Length = 428 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 399 YHPEASPGPHDSDPVFGEFIQLMKQEK 425 >XP_006353536.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 428 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 399 YHPEASPGPHDSDPVFGEFIQLMKQEK 425 >XP_019230362.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic [Nicotiana attenuata] OIT29478.1 carbamoyl-phosphate synthase small chain, chloroplastic [Nicotiana attenuata] Length = 431 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 402 YHPEASPGPHDSDPVFGEFIQLMKQEK 428 >XP_009793979.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic [Nicotiana sylvestris] Length = 431 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 402 YHPEASPGPHDSDPVFGEFIQLMKQEK 428 >XP_006345169.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic-like [Solanum tuberosum] Length = 431 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 402 YHPEASPGPHDSDPVFGEFIQLMKQEK 428 >XP_016453892.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic-like isoform X1 [Nicotiana tabacum] Length = 432 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 403 YHPEASPGPHDSDPVFGEFIQLMKQEK 429 >XP_009610080.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic isoform X1 [Nicotiana tomentosiformis] XP_018628825.1 PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 432 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 541 YHPEASPGPHDSDPVFEEFVKLMKQEK 461 YHPEASPGPHDSDPVF EF++LMKQEK Sbjct: 403 YHPEASPGPHDSDPVFGEFIQLMKQEK 429