BLASTX nr result
ID: Angelica27_contig00020399
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00020399 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017224449.1 PREDICTED: transcription termination factor MTERF... 134 3e-34 KVH97127.1 Mitochodrial transcription termination factor-related... 60 1e-07 XP_019241043.1 PREDICTED: transcription termination factor MTERF... 57 1e-06 >XP_017224449.1 PREDICTED: transcription termination factor MTERF4, chloroplastic [Daucus carota subsp. sativus] Length = 506 Score = 134 bits (336), Expect = 3e-34 Identities = 62/74 (83%), Positives = 67/74 (90%) Frame = -1 Query: 224 MWSFLRKRLYFDSILRNPFHIYPQNLLNSMNCIHKPHQNLCFQEPRVSRIRPFSAQPNKF 45 M S LRKRL+FDSILRNPF++YPQNLL+ MN IHKP QN CFQEP VSRIRPFSAQP+KF Sbjct: 1 MRSLLRKRLHFDSILRNPFYVYPQNLLDCMNSIHKPRQNPCFQEPGVSRIRPFSAQPSKF 60 Query: 44 PEYEMPTVTWGVVQ 3 PEYEMPTVTWGVVQ Sbjct: 61 PEYEMPTVTWGVVQ 74 >KVH97127.1 Mitochodrial transcription termination factor-related protein [Cynara cardunculus var. scolymus] Length = 504 Score = 59.7 bits (143), Expect = 1e-07 Identities = 35/74 (47%), Positives = 42/74 (56%) Frame = -1 Query: 224 MWSFLRKRLYFDSILRNPFHIYPQNLLNSMNCIHKPHQNLCFQEPRVSRIRPFSAQPNKF 45 M LR++ F S L NP H + N + KP Q F RV +PFS + +KF Sbjct: 1 MMFLLRRKQSFKSFLINPLH-FTSNKSKGIIFPPKPSQEPQF---RVLSFQPFSTRSSKF 56 Query: 44 PEYEMPTVTWGVVQ 3 PEYEMPTVTWGVVQ Sbjct: 57 PEYEMPTVTWGVVQ 70 >XP_019241043.1 PREDICTED: transcription termination factor MTERF4, chloroplastic [Nicotiana attenuata] OIT19785.1 transcription termination factor mterf4, chloroplastic [Nicotiana attenuata] Length = 502 Score = 56.6 bits (135), Expect = 1e-06 Identities = 32/74 (43%), Positives = 39/74 (52%) Frame = -1 Query: 224 MWSFLRKRLYFDSILRNPFHIYPQNLLNSMNCIHKPHQNLCFQEPRVSRIRPFSAQPNKF 45 M S LR+ SILR P + + L P + + PRV PFS +KF Sbjct: 1 MSSILRRNQSLKSILRTPKDPFTKPTLKPYK---NPQTSSTYFPPRVLNQIPFSTHSSKF 57 Query: 44 PEYEMPTVTWGVVQ 3 PEYEMPTVTWGV+Q Sbjct: 58 PEYEMPTVTWGVIQ 71