BLASTX nr result
ID: Angelica27_contig00019961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019961 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBI21459.3 unnamed protein product, partial [Vitis vinifera] 72 6e-15 KFK40397.1 hypothetical protein AALP_AA3G368200 [Arabis alpina] 66 5e-13 YP_358581.1 hypothetical protein PhapfoPp032 [Phalaenopsis aphro... 64 1e-11 XP_007159454.1 hypothetical protein PHAVU_002G239000g, partial [... 60 1e-10 KYP62756.1 hypothetical protein KK1_017304, partial [Cajanus cajan] 58 1e-09 XP_006281923.1 hypothetical protein CARUB_v10028130mg [Capsella ... 53 1e-07 >CBI21459.3 unnamed protein product, partial [Vitis vinifera] Length = 79 Score = 72.0 bits (175), Expect = 6e-15 Identities = 35/49 (71%), Positives = 37/49 (75%) Frame = -1 Query: 190 FFIFLF*GSRAIRTRTVDFLGKTYQTFYYQNDLNCFKDPTCNFLCIGLF 44 +FI L RAIRTRTVD LGKT QT YYQNDLNCFKDPTC F +G F Sbjct: 29 YFIGLIYYIRAIRTRTVDLLGKTDQTDYYQNDLNCFKDPTCIFFALGSF 77 >KFK40397.1 hypothetical protein AALP_AA3G368200 [Arabis alpina] Length = 42 Score = 66.2 bits (160), Expect = 5e-13 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 41 MKEPNAQKIACWVFETVQIILIIKSLICFTEKVYGSSPYSP 163 MKEPNA+K ACWVFE V+IILII S FTE+VYGSSPYSP Sbjct: 1 MKEPNAKKNACWVFERVRIILIIISSNSFTEQVYGSSPYSP 41 >YP_358581.1 hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] AAW82556.1 hypothetical protein (chloroplast) [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 64.3 bits (155), Expect = 1e-11 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 163 RAIRTRTVDFLGKTYQTFYYQNDLNCFKDPTCNFL 59 RAIRTRTVD LGKT +T+YY+NDLNCFKDPTC L Sbjct: 57 RAIRTRTVDLLGKTEKTYYYRNDLNCFKDPTCILL 91 >XP_007159454.1 hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] ESW31448.1 hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] Length = 53 Score = 60.5 bits (145), Expect = 1e-10 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -1 Query: 163 RAIRTRTVDFLGKTYQTFYYQNDLNCFKDPTCNFLCIGLF 44 RAIRTRTVD LGKT +T YY ND NCF +PTC FL + F Sbjct: 12 RAIRTRTVDLLGKTAKTHYYLNDFNCFLNPTCIFLLLSFF 51 >KYP62756.1 hypothetical protein KK1_017304, partial [Cajanus cajan] Length = 54 Score = 57.8 bits (138), Expect = 1e-09 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 184 IFLF*GSRAIRTRTVDFLGKTYQTFYYQNDLNCFKDPTCNFLCIGLF 44 I ++ RAIRTRTVD L KT QT YQNDLN FK+PTC F+ + F Sbjct: 6 ISIYRNIRAIRTRTVDLLDKTNQTDSYQNDLNWFKNPTCIFIALSFF 52 >XP_006281923.1 hypothetical protein CARUB_v10028130mg [Capsella rubella] EOA14821.1 hypothetical protein CARUB_v10028130mg [Capsella rubella] Length = 67 Score = 53.1 bits (126), Expect = 1e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -1 Query: 163 RAIRTRTVDFLGKTYQTFYYQNDLNCFKDPTCNFLCI 53 RAIRTRT D LGK +T+YYQND N FKDPT + L I Sbjct: 25 RAIRTRTADLLGKRVRTYYYQNDSNSFKDPTYHTLGI 61