BLASTX nr result
ID: Angelica27_contig00019902
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019902 (623 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM96133.1 hypothetical protein DCAR_019375 [Daucus carota subsp... 55 3e-06 >KZM96133.1 hypothetical protein DCAR_019375 [Daucus carota subsp. sativus] Length = 136 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/57 (54%), Positives = 36/57 (63%), Gaps = 8/57 (14%) Frame = -2 Query: 169 YFLIVANPSWSLGESDPYLGWATRIGC--SHGGLTSSIA------SPLFTDLSLPSL 23 Y LIVANP W GESDPYLGWAT G + + +++A SPLFTDLSL L Sbjct: 6 YNLIVANPGWGSGESDPYLGWATPDGLRFASNWMVAAMAELDPPVSPLFTDLSLTPL 62