BLASTX nr result
ID: Angelica27_contig00019837
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019837 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017240359.1 PREDICTED: inositol hexakisphosphate and diphosph... 59 5e-08 >XP_017240359.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1-like isoform X1 [Daucus carota subsp. sativus] XP_017240360.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1-like isoform X1 [Daucus carota subsp. sativus] Length = 1087 Score = 58.9 bits (141), Expect = 5e-08 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = -3 Query: 107 MEALDKNSIDTTNTN----PYKITIGVCVMEKKVKCGSE 3 MEA + SIDTTNTN P+KITIGVCVMEKKVKCGSE Sbjct: 1 MEAEEGKSIDTTNTNTNTNPFKITIGVCVMEKKVKCGSE 39