BLASTX nr result
ID: Angelica27_contig00019820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019820 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254151.1 PREDICTED: AT-hook motif nuclear-localized protei... 59 1e-07 >XP_017254151.1 PREDICTED: AT-hook motif nuclear-localized protein 7 [Daucus carota subsp. sativus] Length = 359 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 1 VVAAENNILLPGESQPIVAAENKISMPLNSEKLSPSKCVISC 126 VV AENN+ +PG+ Q +VAAEN IS P SE LSPSKC++SC Sbjct: 318 VVPAENNMPMPGDGQTMVAAENNISKPGESENLSPSKCMVSC 359