BLASTX nr result
ID: Angelica27_contig00019767
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019767 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM95123.1 hypothetical protein DCAR_018365 [Daucus carota subsp... 56 4e-07 >KZM95123.1 hypothetical protein DCAR_018365 [Daucus carota subsp. sativus] Length = 386 Score = 55.8 bits (133), Expect = 4e-07 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = +1 Query: 124 WYPKLNKGLQELLSPRTLI--CRKMLKNRSRSIFLSRTLNYPSLNRHFATQ 270 WY KL +GLQ+LLS RT I RKMLK+RSR IFLS TLN +R F+ Q Sbjct: 68 WYLKLKEGLQKLLSSRTQINSSRKMLKSRSRCIFLSGTLNSRGFDRRFSAQ 118