BLASTX nr result
ID: Angelica27_contig00019716
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019716 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017256871.1 PREDICTED: 24-methylenesterol C-methyltransferase... 56 3e-07 XP_017256870.1 PREDICTED: 24-methylenesterol C-methyltransferase... 52 6e-06 >XP_017256871.1 PREDICTED: 24-methylenesterol C-methyltransferase 2-like [Daucus carota subsp. sativus] Length = 393 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 6/54 (11%) Frame = +2 Query: 95 HSTLPSSIYTHNYTYTQNP------TMDTLPLVFSALLIAGGFYWFICILGSAE 238 +S P +H YT+T + MDTLPL+ + LI GGFYWFIC+LGSAE Sbjct: 13 NSIKPRPSLSHLYTHTSHSHPIVHTAMDTLPLLLTTALIGGGFYWFICVLGSAE 66 >XP_017256870.1 PREDICTED: 24-methylenesterol C-methyltransferase 2-like [Daucus carota subsp. sativus] Length = 412 Score = 52.0 bits (123), Expect = 6e-06 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 5/54 (9%) Frame = +2 Query: 92 NHSTLPSSIYTHN-----YTYTQNPTMDTLPLVFSALLIAGGFYWFICILGSAE 238 N ST P S+Y + +TY MDTLP++F+ +I GG YWFICILGS E Sbjct: 33 NRST-PLSLYKQDASYLLHTYHTLRAMDTLPMLFTTAVIVGGLYWFICILGSPE 85