BLASTX nr result
ID: Angelica27_contig00019562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019562 (218 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017227767.1 PREDICTED: protein FMP32, mitochondrial [Daucus c... 54 5e-07 >XP_017227767.1 PREDICTED: protein FMP32, mitochondrial [Daucus carota subsp. sativus] KZM80762.1 hypothetical protein DCAR_031673 [Daucus carota subsp. sativus] Length = 228 Score = 54.3 bits (129), Expect = 5e-07 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +1 Query: 82 MSAFAATRKEATSHLGSLFGSNLTRFNLSPPFINRINTHHFSKLV 216 M+ FAATRKEA + + SL GS R NLSPP N +N+HHFSKLV Sbjct: 1 MAGFAATRKEARNTIASLLGS---RLNLSPPIRNGMNSHHFSKLV 42