BLASTX nr result
ID: Angelica27_contig00019475
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019475 (677 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017248663.1 PREDICTED: pentatricopeptide repeat-containing pr... 147 1e-37 XP_017243797.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 2e-29 KZM98892.1 hypothetical protein DCAR_013746 [Daucus carota subsp... 119 2e-27 XP_002269984.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 2e-21 XP_015888425.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 7e-21 XP_017979527.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 3e-20 EOY13804.1 Pentatricopeptide repeat (PPR) superfamily protein [T... 99 3e-20 XP_018838768.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 4e-19 XP_018825163.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 7e-19 OAY30238.1 hypothetical protein MANES_14G015600 [Manihot esculenta] 94 2e-18 XP_002513427.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 5e-18 XP_011095678.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 5e-18 XP_012087429.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 6e-18 CDP13612.1 unnamed protein product [Coffea canephora] 92 6e-18 XP_010246803.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 2e-17 XP_010667980.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 5e-17 KNA09301.1 hypothetical protein SOVF_154310 [Spinacia oleracea] 89 7e-17 XP_002317023.2 hypothetical protein POPTR_0011s14750g [Populus t... 89 7e-17 XP_011653982.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 1e-16 XP_008383030.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 1e-16 >XP_017248663.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Daucus carota subsp. sativus] KZM93575.1 hypothetical protein DCAR_016820 [Daucus carota subsp. sativus] Length = 567 Score = 147 bits (371), Expect = 1e-37 Identities = 68/84 (80%), Positives = 77/84 (91%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 MSALMNL +PI+SP EQTRMCSGF LQIPHVHSF +KGFSRVLAS HMA+PSKD+VFT Sbjct: 1 MSALMNLVAPIMSPSAEQTRMCSGFSLQIPHVHSFSPAKGFSRVLASTHMAVPSKDSVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 IPNWR+GKNDAR++DYR+NDAFLY Sbjct: 61 IPNWRHGKNDARTKDYRMNDAFLY 84 >XP_017243797.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Daucus carota subsp. sativus] Length = 567 Score = 124 bits (312), Expect = 2e-29 Identities = 60/84 (71%), Positives = 67/84 (79%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 MSA +N SPI +P VEQ+R CSGF QIPHV SF +KGFSRV AS H+AI KD+VFT Sbjct: 1 MSAFINSVSPIKNPSVEQSRKCSGFSWQIPHVQSFSFTKGFSRVFASAHVAISPKDSVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 IPNWR GKND RS+DYRLNDAFLY Sbjct: 61 IPNWRNGKNDGRSKDYRLNDAFLY 84 >KZM98892.1 hypothetical protein DCAR_013746 [Daucus carota subsp. sativus] Length = 575 Score = 119 bits (297), Expect = 2e-27 Identities = 56/76 (73%), Positives = 62/76 (81%) Frame = +3 Query: 450 SPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFTIPNWRYGK 629 SPI +P VEQ+R CSGF QIPHV SF +KGFSRV AS H+AI KD+VFTIPNWR GK Sbjct: 17 SPIKNPSVEQSRKCSGFSWQIPHVQSFSFTKGFSRVFASAHVAISPKDSVFTIPNWRNGK 76 Query: 630 NDARSRDYRLNDAFLY 677 ND RS+DYRLNDAFLY Sbjct: 77 NDGRSKDYRLNDAFLY 92 >XP_002269984.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic isoform X1 [Vitis vinifera] CAN82234.1 hypothetical protein VITISV_038804 [Vitis vinifera] Length = 567 Score = 102 bits (254), Expect = 2e-21 Identities = 49/84 (58%), Positives = 60/84 (71%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+N SPI SP E R GF Q+P++H+ ++KGFSRVLAS + I KD VFT Sbjct: 1 MAILVNAMSPITSPSPENARKVCGFFSQVPNLHTLSLNKGFSRVLASTQITISPKDNVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNWR GKND R+RD RLNDAFLY Sbjct: 61 LPNWRSGKNDPRTRDLRLNDAFLY 84 >XP_015888425.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Ziziphus jujuba] Length = 568 Score = 100 bits (249), Expect = 7e-21 Identities = 47/84 (55%), Positives = 62/84 (73%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+N SPI P E +R GF +P++H+F V+KGF+RVLAS + I KDTVFT Sbjct: 1 MAILLNPVSPIAHPSPETSRKSCGFFSHVPNLHTFSVNKGFARVLASTPITISPKDTVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNWR GKND RS+++RLNDAFL+ Sbjct: 61 VPNWRTGKNDTRSKEFRLNDAFLH 84 >XP_017979527.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Theobroma cacao] Length = 568 Score = 98.6 bits (244), Expect = 3e-20 Identities = 45/84 (53%), Positives = 62/84 (73%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+N SP+ +P E TR GF QIP++HSF ++KGF+RVLA+ + I KD+VFT Sbjct: 1 MATLLNSMSPMTNPSPETTRKTCGFFYQIPNLHSFSLNKGFTRVLATTQITISPKDSVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNW+ GKND +SR+ RLNDAF + Sbjct: 61 LPNWKTGKNDTKSRELRLNDAFFH 84 >EOY13804.1 Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 568 Score = 98.6 bits (244), Expect = 3e-20 Identities = 45/84 (53%), Positives = 62/84 (73%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+N SP+ +P E TR GF QIP++HSF ++KGF+RVLA+ + I KD+VFT Sbjct: 1 MATLLNSMSPMTNPSPETTRKTCGFFYQIPNLHSFSLNKGFTRVLATTQITISPKDSVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNW+ GKND +SR+ RLNDAF + Sbjct: 61 LPNWKTGKNDTKSRELRLNDAFFH 84 >XP_018838768.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like, partial [Juglans regia] Length = 397 Score = 94.7 bits (234), Expect = 4e-19 Identities = 46/85 (54%), Positives = 64/85 (75%), Gaps = 1/85 (1%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCS-GFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVF 602 M+ ++N SP+ +P E R + GF IP++H+F ++KGFS+VLAS + I KDTVF Sbjct: 1 MATVLNSVSPVGNPSPEGIRRGNYGFFSHIPNLHTFSLNKGFSKVLASTQITISPKDTVF 60 Query: 603 TIPNWRYGKNDARSRDYRLNDAFLY 677 T+PNWRYGK+D+RSR+ RLNDAFL+ Sbjct: 61 TLPNWRYGKSDSRSRELRLNDAFLH 85 >XP_018825163.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Juglans regia] Length = 568 Score = 94.7 bits (234), Expect = 7e-19 Identities = 46/85 (54%), Positives = 64/85 (75%), Gaps = 1/85 (1%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCS-GFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVF 602 M+ ++N SP+ +P E R + GF IP++H+F ++KGFS+VLAS + I KDTVF Sbjct: 1 MATVLNSVSPVGNPSPEGIRRGNYGFFSHIPNLHTFSLNKGFSKVLASTQITISPKDTVF 60 Query: 603 TIPNWRYGKNDARSRDYRLNDAFLY 677 T+PNWRYGK+D+RSR+ RLNDAFL+ Sbjct: 61 TLPNWRYGKSDSRSRELRLNDAFLH 85 >OAY30238.1 hypothetical protein MANES_14G015600 [Manihot esculenta] Length = 567 Score = 93.6 bits (231), Expect = 2e-18 Identities = 42/84 (50%), Positives = 61/84 (72%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+N SP+ +P+ E R+ GF IP++HSF ++KGF++VLAS + I KD+V + Sbjct: 1 MATLVNSVSPLTNPFPEAARIACGFFSHIPNLHSFSLNKGFTKVLASTQITISPKDSVVS 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNWR GKND RSR+ RLNDA+ + Sbjct: 61 LPNWRSGKNDHRSREIRLNDAYFH 84 >XP_002513427.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Ricinus communis] EEF48830.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 92.4 bits (228), Expect = 5e-18 Identities = 41/84 (48%), Positives = 61/84 (72%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M++L++ SP+ +P+ E R+ GF IP++HSF ++K F+RVLAS + I KD+V T Sbjct: 1 MASLVHSVSPLTNPFTEAARIACGFFSHIPNLHSFSLNKDFTRVLASTQITISPKDSVIT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNWR GKND R+RD R++DAF + Sbjct: 61 LPNWRSGKNDQRNRDMRISDAFFH 84 >XP_011095678.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Sesamum indicum] Length = 574 Score = 92.4 bits (228), Expect = 5e-18 Identities = 43/84 (51%), Positives = 60/84 (71%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L++ SPI +P + +RM SGF Q+P SF ++ G S+VL+S +AI KD VFT Sbjct: 1 MAILLHSSSPIANPLTKNSRMPSGFLAQVPKFQSFPLNNGSSKVLSSTQVAIAPKDGVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNW+ G+ND R+R+ RLNDAFLY Sbjct: 61 LPNWKSGRNDPRTREVRLNDAFLY 84 >XP_012087429.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Jatropha curcas] KDP25129.1 hypothetical protein JCGZ_22664 [Jatropha curcas] Length = 567 Score = 92.0 bits (227), Expect = 6e-18 Identities = 42/84 (50%), Positives = 60/84 (71%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M++L+N SP+ + E R+ GF +P++HSF ++KGF+RVLAS + I KD+V T Sbjct: 1 MASLVNSVSPLTKAFPEAARIACGFFSHVPNLHSFSLNKGFTRVLASTQITISPKDSVAT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNWR GKND RSR+ RL+DAF + Sbjct: 61 LPNWRSGKNDQRSREIRLSDAFFH 84 >CDP13612.1 unnamed protein product [Coffea canephora] Length = 568 Score = 92.0 bits (227), Expect = 6e-18 Identities = 43/84 (51%), Positives = 58/84 (69%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+N SPI P E +R +GF ++ HSF ++ GF R+LAS A SKDTVFT Sbjct: 1 MAVLLNSVSPIKHPSSEHSRNSAGFSSKVLKFHSFSLNNGFPRLLASTQTAFASKDTVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNWR G+ND R+++ R+NDAFLY Sbjct: 61 LPNWRSGRNDPRTKELRMNDAFLY 84 >XP_010246803.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Nelumbo nucifera] Length = 562 Score = 90.5 bits (223), Expect = 2e-17 Identities = 42/84 (50%), Positives = 62/84 (73%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M AL++ +P+ +P + TR F Q+P++HS ++ GFSRVLA+ H+ IPSK+TVFT Sbjct: 1 MVALLHSVTPLPTPASDATRKPCCFFSQLPNLHSLSLNNGFSRVLAATHVTIPSKETVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +P+WR KND ++R+ +LNDAFLY Sbjct: 61 LPSWRNVKNDPKTRELKLNDAFLY 84 >XP_010667980.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Beta vulgaris subsp. vulgaris] KMS94993.1 hypothetical protein BVRB_013430 [Beta vulgaris subsp. vulgaris] Length = 566 Score = 89.4 bits (220), Expect = 5e-17 Identities = 44/84 (52%), Positives = 62/84 (73%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+AL+ SPI +P +E T GF QIP++H+ ++KGFSRVLAS + I S ++VFT Sbjct: 1 MAALLQSLSPITNPCLENTIKACGFFSQIPNLHTVSLNKGFSRVLASNQITI-SSNSVFT 59 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNWR GKND +S++ ++NDAFLY Sbjct: 60 LPNWRNGKNDPKSKEIKVNDAFLY 83 >KNA09301.1 hypothetical protein SOVF_154310 [Spinacia oleracea] Length = 566 Score = 89.0 bits (219), Expect = 7e-17 Identities = 43/84 (51%), Positives = 62/84 (73%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+ SPI +P +E T SGF QIP++H+ ++KGFSRVLAS + I S ++VFT Sbjct: 1 MATLLQSLSPITNPCLESTVKASGFFSQIPNLHTLSLNKGFSRVLASNQVTI-SSNSVFT 59 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNWR GKND ++++ ++NDAFLY Sbjct: 60 LPNWRTGKNDPKTKEIKVNDAFLY 83 >XP_002317023.2 hypothetical protein POPTR_0011s14750g [Populus trichocarpa] EEE97635.2 hypothetical protein POPTR_0011s14750g [Populus trichocarpa] Length = 567 Score = 89.0 bits (219), Expect = 7e-17 Identities = 40/84 (47%), Positives = 58/84 (69%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+N SP++SP E R GF +P+ +SF ++KGF+RVLAS + I KD+V T Sbjct: 1 MATLVNSVSPLISPSPETARTACGFFSNVPNFYSFSLNKGFTRVLASTQITISPKDSVLT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNW+ G+N R+R+ RLNDAF + Sbjct: 61 LPNWKVGRNGTRNREIRLNDAFFH 84 >XP_011653982.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Cucumis sativus] KGN54942.1 hypothetical protein Csa_4G613170 [Cucumis sativus] Length = 566 Score = 88.6 bits (218), Expect = 1e-16 Identities = 41/84 (48%), Positives = 57/84 (67%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+N SPI +P E TR GF IP++ ++KGFS+VLAS + I KDT+FT Sbjct: 1 MATLLNTVSPITNPSPETTRRGCGFFSHIPNIQKLSLNKGFSKVLASTQITISPKDTIFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNW+ GK D +S++ RLNDAF + Sbjct: 61 LPNWKIGKLDQKSKELRLNDAFFH 84 >XP_008383030.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Malus domestica] XP_008383031.1 PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Malus domestica] Length = 567 Score = 88.6 bits (218), Expect = 1e-16 Identities = 45/84 (53%), Positives = 56/84 (66%) Frame = +3 Query: 426 MSALMNLGSPIVSPYVEQTRMCSGFPLQIPHVHSFGVSKGFSRVLASIHMAIPSKDTVFT 605 M+ L+N SPI P E TR GF I ++ +SKGFSRVLA+ + I KDTVFT Sbjct: 1 MAVLVNSVSPIAHPSPEATRKTCGFFSHIRNLQPLSLSKGFSRVLATTQITISPKDTVFT 60 Query: 606 IPNWRYGKNDARSRDYRLNDAFLY 677 +PNWR+ KND RSR+ RL DAFL+ Sbjct: 61 LPNWRHAKNDRRSRELRLIDAFLH 84