BLASTX nr result
ID: Angelica27_contig00019430
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019430 (234 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017234228.1 PREDICTED: protein LOW PSII ACCUMULATION 1, chlor... 54 9e-07 >XP_017234228.1 PREDICTED: protein LOW PSII ACCUMULATION 1, chloroplastic-like [Daucus carota subsp. sativus] XP_017234241.1 PREDICTED: protein LOW PSII ACCUMULATION 1, chloroplastic-like [Daucus carota subsp. sativus] XP_017234249.1 PREDICTED: protein LOW PSII ACCUMULATION 1, chloroplastic-like [Daucus carota subsp. sativus] KZN12042.1 hypothetical protein DCAR_004698 [Daucus carota subsp. sativus] Length = 320 Score = 54.3 bits (129), Expect = 9e-07 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 8/60 (13%) Frame = +1 Query: 79 MSMIIISNLGH-PKILGFSRQFNPKDSTFIS-------SPFQWRRKQLRFLLTCSASDKP 234 MS+II S+ GH PK+ SRQ P++S +I SP Q RRK LRF LTC ASDKP Sbjct: 1 MSVIITSSFGHHPKLSALSRQIIPENSVYIFPTVTITISPIQLRRKGLRFSLTCFASDKP 60