BLASTX nr result
ID: Angelica27_contig00019341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019341 (502 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM98956.1 hypothetical protein DCAR_013682 [Daucus carota subsp... 77 7e-14 XP_017246708.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [D... 77 9e-14 XP_009353126.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [P... 66 1e-09 XP_009366461.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [P... 65 2e-09 XP_008350130.1 PREDICTED: LOW QUALITY PROTEIN: 5'-adenylylsulfat... 65 2e-09 AEK94318.1 disulfide isomerase-related protein [Pyrus x bretschn... 65 2e-09 XP_008391699.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [M... 64 4e-09 OMO92582.1 Thioredoxin-like protein [Corchorus capsularis] 63 8e-09 KHG25608.1 5'-adenylylsulfate reductase-like 5 [Gossypium arboreum] 63 1e-08 XP_012434762.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [G... 63 1e-08 XP_017612554.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [G... 63 1e-08 XP_016755011.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [G... 62 2e-08 XP_016680307.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [G... 62 2e-08 KDO55017.1 hypothetical protein CISIN_1g0462601mg, partial [Citr... 59 3e-08 GAV78955.1 Thioredoxin domain-containing protein [Cephalotus fol... 62 3e-08 XP_012844235.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [E... 62 3e-08 ERN20398.1 hypothetical protein AMTR_s00068p00075130 [Amborella ... 60 3e-08 XP_017624163.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [G... 61 4e-08 XP_016724455.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [G... 61 5e-08 OMO55274.1 Thioredoxin-like protein [Corchorus olitorius] 61 5e-08 >KZM98956.1 hypothetical protein DCAR_013682 [Daucus carota subsp. sativus] Length = 282 Score = 77.0 bits (188), Expect = 7e-14 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKLKLC+TR+F++GAKNAR WASSLASVSLGKTASCRSSS Sbjct: 242 WTKLKLCKTRNFLHGAKNARVWASSLASVSLGKTASCRSSS 282 >XP_017246708.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Daucus carota subsp. sativus] Length = 304 Score = 77.0 bits (188), Expect = 9e-14 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKLKLC+TR+F++GAKNAR WASSLASVSLGKTASCRSSS Sbjct: 264 WTKLKLCKTRNFLHGAKNARVWASSLASVSLGKTASCRSSS 304 >XP_009353126.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Pyrus x bretschneideri] Length = 299 Score = 65.9 bits (159), Expect = 1e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F GAKNAR WASSL SVSLGK++S RSSS Sbjct: 256 WTKLRLCKTRNFHEGAKNARVWASSLTSVSLGKSSSARSSS 296 >XP_009366461.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Pyrus x bretschneideri] Length = 296 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F GAKNAR WASSL SVSLGK++S RSS+ Sbjct: 255 WTKLRLCKTRNFHEGAKNARVWASSLTSVSLGKSSSARSST 295 >XP_008350130.1 PREDICTED: LOW QUALITY PROTEIN: 5'-adenylylsulfate reductase-like 5 [Malus domestica] Length = 296 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F GAKNAR WASSL SVSLGK++S RSS+ Sbjct: 255 WTKLRLCKTRNFHKGAKNARVWASSLTSVSLGKSSSARSST 295 >AEK94318.1 disulfide isomerase-related protein [Pyrus x bretschneideri] Length = 297 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F GAKNAR WASSL SVSLGK++S RSS+ Sbjct: 256 WTKLRLCKTRNFHEGAKNARVWASSLTSVSLGKSSSARSST 296 >XP_008391699.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Malus domestica] Length = 305 Score = 64.3 bits (155), Expect = 4e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F GAKNAR WASSL SVSLG+++S RSSS Sbjct: 256 WTKLRLCKTRNFHEGAKNARVWASSLTSVSLGESSSARSSS 296 >OMO92582.1 Thioredoxin-like protein [Corchorus capsularis] Length = 281 Score = 63.2 bits (152), Expect = 8e-09 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F +GAK+AR WASSLASVSLG+++S RSSS Sbjct: 239 WTKLRLCKTRNFHHGAKSARVWASSLASVSLGESSSGRSSS 279 >KHG25608.1 5'-adenylylsulfate reductase-like 5 [Gossypium arboreum] Length = 269 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F GA++AR WASSLASVSLGK++S RSSS Sbjct: 227 WTKLRLCKTRNFHQGAESARVWASSLASVSLGKSSSGRSSS 267 >XP_012434762.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Gossypium raimondii] KJB46049.1 hypothetical protein B456_007G345900 [Gossypium raimondii] Length = 299 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F GA++AR WASSLASVSLGK++S RSSS Sbjct: 257 WTKLRLCKTRNFHQGAESARVWASSLASVSLGKSSSGRSSS 297 >XP_017612554.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Gossypium arboreum] KHG25607.1 5'-adenylylsulfate reductase-like 7 [Gossypium arboreum] Length = 299 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F GA++AR WASSLASVSLGK++S RSSS Sbjct: 257 WTKLRLCKTRNFHQGAESARVWASSLASVSLGKSSSGRSSS 297 >XP_016755011.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Gossypium hirsutum] Length = 299 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F GA+ AR WASSLASVSLGK++S RSSS Sbjct: 257 WTKLRLCKTRNFHQGAERARVWASSLASVSLGKSSSGRSSS 297 >XP_016680307.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Gossypium hirsutum] Length = 312 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+T++F GAK+AR WASSLASVSLG+++S RSSS Sbjct: 268 WTKLRLCKTQNFQQGAKSARVWASSLASVSLGESSSARSSS 308 >KDO55017.1 hypothetical protein CISIN_1g0462601mg, partial [Citrus sinensis] Length = 136 Score = 59.3 bits (142), Expect = 3e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = +1 Query: 4 TKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 TKL++C+TR+F GAKNAR WASSLASVSLG+++S R+SS Sbjct: 97 TKLRICKTRNFREGAKNARVWASSLASVSLGESSSTRTSS 136 >GAV78955.1 Thioredoxin domain-containing protein [Cephalotus follicularis] Length = 296 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F +GA NAR WASSLASVSLG+++S RSSS Sbjct: 257 WTKLRLCKTRNF-HGAMNARAWASSLASVSLGQSSSARSSS 296 >XP_012844235.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Erythranthe guttata] EYU31671.1 hypothetical protein MIMGU_mgv1a010641mg [Erythranthe guttata] Length = 306 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCR 114 W KLK C+TR+F+ GA+NAR WASSLASVSLGKT+S R Sbjct: 266 WNKLKNCKTRNFVKGARNARVWASSLASVSLGKTSSSR 303 >ERN20398.1 hypothetical protein AMTR_s00068p00075130 [Amborella trichopoda] Length = 202 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 W++L+LC+TR+F GAKNAR WASSLASVS+G+ +S RSS+ Sbjct: 157 WSRLRLCKTRNFEKGAKNARVWASSLASVSIGEASSTRSSA 197 >XP_017624163.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Gossypium arboreum] Length = 309 Score = 61.2 bits (147), Expect = 4e-08 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+T++F GAK+AR WASSLASV+LG+++S RSSS Sbjct: 265 WTKLRLCKTQNFQQGAKSARVWASSLASVALGESSSARSSS 305 >XP_016724455.1 PREDICTED: 5'-adenylylsulfate reductase-like 5 [Gossypium hirsutum] Length = 312 Score = 61.2 bits (147), Expect = 5e-08 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+T++F GAK+AR WASSLASV+LG+++S RSSS Sbjct: 268 WTKLRLCKTQNFQQGAKSARVWASSLASVALGESSSARSSS 308 >OMO55274.1 Thioredoxin-like protein [Corchorus olitorius] Length = 281 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +1 Query: 1 WTKLKLCQTRSFINGAKNARGWASSLASVSLGKTASCRSSS 123 WTKL+LC+TR+F + AK+AR WASSLASVSLG+++S RSSS Sbjct: 239 WTKLRLCKTRNFHHSAKSARVWASSLASVSLGESSSGRSSS 279