BLASTX nr result
ID: Angelica27_contig00019218
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019218 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM83559.1 hypothetical protein DCAR_031128 [Daucus carota subsp... 72 4e-13 XP_017224186.1 PREDICTED: phosphatidylinositol-glycan biosynthes... 67 1e-11 XP_017224185.1 PREDICTED: phosphatidylinositol-glycan biosynthes... 67 1e-11 >KZM83559.1 hypothetical protein DCAR_031128 [Daucus carota subsp. sativus] Length = 356 Score = 72.0 bits (175), Expect = 4e-13 Identities = 38/52 (73%), Positives = 40/52 (76%) Frame = -3 Query: 221 DDSIVWAVPSGNKKHAXXXXXXXXXSAILTALSIVLVSIHHSNFETNDYKQS 66 DDSIVW VPSGNKKHA SAIL+ALSIVLVSI HSNFET+D KQS Sbjct: 305 DDSIVWEVPSGNKKHASTVSFLTFVSAILSALSIVLVSIRHSNFETDDSKQS 356 >XP_017224186.1 PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein isoform X2 [Daucus carota subsp. sativus] Length = 292 Score = 67.4 bits (163), Expect = 1e-11 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -3 Query: 221 DDSIVWAVPSGNKKHAXXXXXXXXXSAILTALSIVLVSIHHSNFETND 78 DDSIVW VPSGNKKHA SAIL+ALSIVLVSI HSNFET+D Sbjct: 244 DDSIVWEVPSGNKKHASTVSFLTFVSAILSALSIVLVSIRHSNFETDD 291 >XP_017224185.1 PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein isoform X1 [Daucus carota subsp. sativus] Length = 301 Score = 67.4 bits (163), Expect = 1e-11 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -3 Query: 221 DDSIVWAVPSGNKKHAXXXXXXXXXSAILTALSIVLVSIHHSNFETND 78 DDSIVW VPSGNKKHA SAIL+ALSIVLVSI HSNFET+D Sbjct: 244 DDSIVWEVPSGNKKHASTVSFLTFVSAILSALSIVLVSIRHSNFETDD 291