BLASTX nr result
ID: Angelica27_contig00019182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00019182 (451 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237855.1 PREDICTED: ATPase family AAA domain-containing pr... 66 7e-10 >XP_017237855.1 PREDICTED: ATPase family AAA domain-containing protein 3-B [Daucus carota subsp. sativus] KZN00258.1 hypothetical protein DCAR_009012 [Daucus carota subsp. sativus] Length = 635 Score = 66.2 bits (160), Expect = 7e-10 Identities = 37/64 (57%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Frame = +2 Query: 269 MVKGALTAGLFSAI---LGGVQCVYADGPPFNFAPFSTSSTSNSQXXXXXXXXXXXXXXV 439 MVKG TAGLFSAI +GGV+CVYADG PFNFAP S S SNSQ V Sbjct: 1 MVKGVATAGLFSAIASAIGGVECVYADGLPFNFAPLSGSPVSNSQAPGASGGAGDKGKGV 60 Query: 440 ESKE 451 ES+E Sbjct: 61 ESEE 64