BLASTX nr result
ID: Angelica27_contig00018417
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018417 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017230845.1 PREDICTED: ras-related protein Rab11D-like [Daucu... 65 9e-11 >XP_017230845.1 PREDICTED: ras-related protein Rab11D-like [Daucus carota subsp. sativus] KZN10822.1 hypothetical protein DCAR_003478 [Daucus carota subsp. sativus] Length = 224 Score = 65.5 bits (158), Expect = 9e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 305 EEQSNGNPPPPAGKQILVPGPGQIIPPKRSM 213 E+QSNGN PPPAGKQILVPGPGQIIPPKRSM Sbjct: 190 EDQSNGNAPPPAGKQILVPGPGQIIPPKRSM 220