BLASTX nr result
ID: Angelica27_contig00018280
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018280 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017238896.1 PREDICTED: thaumatin-like protein 1 [Daucus carot... 70 1e-12 XP_017257032.1 PREDICTED: thaumatin-like protein 1 [Daucus carot... 60 8e-09 KZM92320.1 hypothetical protein DCAR_020315 [Daucus carota subsp... 59 2e-08 XP_017256982.1 PREDICTED: thaumatin-like protein 1 [Daucus carot... 58 4e-08 XP_017257157.1 PREDICTED: thaumatin-like protein 1 [Daucus carot... 54 8e-07 XP_017228098.1 PREDICTED: thaumatin-like protein 1 [Daucus carot... 54 1e-06 XP_017216969.1 PREDICTED: thaumatin-like protein 1 [Daucus carot... 52 8e-06 XP_017218088.1 PREDICTED: thaumatin-like protein 1 [Daucus carot... 52 8e-06 >XP_017238896.1 PREDICTED: thaumatin-like protein 1 [Daucus carota subsp. sativus] Length = 233 Score = 70.1 bits (170), Expect = 1e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 139 VVLHTLFALSVAAILLLGGESATFIIRNNCPYTIWPAA 252 + LHTLFALSVAAILLLG ESATFII+N CPYTIWPAA Sbjct: 1 MALHTLFALSVAAILLLGAESATFIIKNACPYTIWPAA 38 >XP_017257032.1 PREDICTED: thaumatin-like protein 1 [Daucus carota subsp. sativus] KZM92321.1 hypothetical protein DCAR_020314 [Daucus carota subsp. sativus] Length = 235 Score = 59.7 bits (143), Expect = 8e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 151 TLFALSVAAILLLGGESATFIIRNNCPYTIWPAA 252 TL ALS AA+LL+GGESATF I+NNCP TIWPAA Sbjct: 5 TLLALSFAALLLIGGESATFTIKNNCPMTIWPAA 38 >KZM92320.1 hypothetical protein DCAR_020315 [Daucus carota subsp. sativus] Length = 205 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 136 MVVLHTLFALSVAAILLLGGESATFIIRNNCPYTIWPAA 252 M +L ALS AA+LL+GGESATF I+NNCP TIWPAA Sbjct: 1 MAAQTSLLALSFAALLLIGGESATFTIKNNCPMTIWPAA 39 >XP_017256982.1 PREDICTED: thaumatin-like protein 1 [Daucus carota subsp. sativus] KZM92322.1 hypothetical protein DCAR_020313 [Daucus carota subsp. sativus] Length = 234 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 145 LHTLFALSVAAILLLGGESATFIIRNNCPYTIWPAA 252 L TLFA AA+LL+GGESA F IRNNCP TIWPAA Sbjct: 3 LQTLFAFYFAALLLVGGESAIFTIRNNCPNTIWPAA 38 >XP_017257157.1 PREDICTED: thaumatin-like protein 1 [Daucus carota subsp. sativus] KZM92324.1 hypothetical protein DCAR_020311 [Daucus carota subsp. sativus] Length = 237 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 154 LFALSVAAILLLGGESATFIIRNNCPYTIWPAA 252 LFA+ A +LL+GGESATF I NNCP TIWPAA Sbjct: 6 LFAVPFAVLLLIGGESATFTITNNCPMTIWPAA 38 >XP_017228098.1 PREDICTED: thaumatin-like protein 1 [Daucus carota subsp. sativus] XP_017256955.1 PREDICTED: thaumatin-like protein 1 [Daucus carota subsp. sativus] KZM80154.1 hypothetical protein DCAR_000146 [Daucus carota subsp. sativus] KZM92323.1 hypothetical protein DCAR_020312 [Daucus carota subsp. sativus] Length = 234 Score = 53.9 bits (128), Expect = 1e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +1 Query: 139 VVLHTLFALSVAAILLLGGESATFIIRNNCPYTIWPAA 252 + L TL A S AA+LL+GGE+A F I NNCP TIWPAA Sbjct: 1 MALQTLLAFSFAALLLVGGEAAKFTIVNNCPNTIWPAA 38 >XP_017216969.1 PREDICTED: thaumatin-like protein 1 [Daucus carota subsp. sativus] Length = 232 Score = 51.6 bits (122), Expect = 8e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +1 Query: 154 LFALSVAAILLLGGESATFIIRNNCPYTIWPA 249 L ALS A +LGGE+ATF I NNCPYTIWPA Sbjct: 6 LLALSFVASSILGGETATFTITNNCPYTIWPA 37 >XP_017218088.1 PREDICTED: thaumatin-like protein 1 [Daucus carota subsp. sativus] KZM86633.1 hypothetical protein DCAR_023767 [Daucus carota subsp. sativus] Length = 233 Score = 51.6 bits (122), Expect = 8e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +1 Query: 154 LFALSVAAILLLGGESATFIIRNNCPYTIWPA 249 L ALS A +LGGE+ATF I NNCPYTIWPA Sbjct: 6 LLALSFVASSILGGETATFTITNNCPYTIWPA 37