BLASTX nr result
ID: Angelica27_contig00018254
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018254 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243082.1 PREDICTED: cytochrome c oxidase subunit 6b-1 [Dau... 55 1e-07 >XP_017243082.1 PREDICTED: cytochrome c oxidase subunit 6b-1 [Daucus carota subsp. sativus] KZN00824.1 hypothetical protein DCAR_009578 [Daucus carota subsp. sativus] Length = 209 Score = 55.5 bits (132), Expect = 1e-07 Identities = 35/77 (45%), Positives = 42/77 (54%), Gaps = 6/77 (7%) Frame = +3 Query: 3 KTPSLSEQYHLEKEEKLNAAPKPAEEVILVDXXXXXXXXXXXXXXXXXXXXPE------A 164 +TP+LS+QYHLEKE+ LN A KP EEV++ D PE A Sbjct: 6 QTPTLSQQYHLEKEQ-LNTASKPVEEVVVPDSATEAVKEAVTAEVEESSSTPESSETPDA 64 Query: 165 ASGVGSETPEAASGESS 215 ASG SETP AAS +SS Sbjct: 65 ASGESSETPVAASSDSS 81