BLASTX nr result
ID: Angelica27_contig00018187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018187 (216 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017230885.1 PREDICTED: thioredoxin O1, mitochondrial-like iso... 62 2e-10 >XP_017230885.1 PREDICTED: thioredoxin O1, mitochondrial-like isoform X2 [Daucus carota subsp. sativus] KZN08224.1 hypothetical protein DCAR_001289 [Daucus carota subsp. sativus] Length = 162 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 94 MSSPSTAPPHYYSTSXXXXXXPYFEWYKNPAASLFQFSHPL 216 M+SPSTAPP Y+++ PYFEWYKNPAAS+FQFSHPL Sbjct: 1 MASPSTAPP--YNSTYSDNSKPYFEWYKNPAASMFQFSHPL 39