BLASTX nr result
ID: Angelica27_contig00018183
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018183 (525 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN04545.1 hypothetical protein DCAR_005382 [Daucus carota subsp... 59 4e-07 XP_017235859.1 PREDICTED: DEAD-box ATP-dependent RNA helicase 31... 59 4e-07 >KZN04545.1 hypothetical protein DCAR_005382 [Daucus carota subsp. sativus] Length = 809 Score = 59.3 bits (142), Expect = 4e-07 Identities = 38/75 (50%), Positives = 45/75 (60%) Frame = -2 Query: 344 LDRVIPISPRVLPEKLKNQFLLHNNIGSLNFTSQVEPQFGGVLEYSSRGTGLKMRAFKNL 165 L R+IPISPRV L H+NIG LN+ S F G + LKMRA KNL Sbjct: 9 LTRLIPISPRV-------PSLSHSNIGFLNYPSH----FAGT-------SCLKMRASKNL 50 Query: 164 IEDEPVLDWDMRSET 120 IEDEPVLDW +RS++ Sbjct: 51 IEDEPVLDWGLRSDS 65 >XP_017235859.1 PREDICTED: DEAD-box ATP-dependent RNA helicase 31-like [Daucus carota subsp. sativus] Length = 847 Score = 59.3 bits (142), Expect = 4e-07 Identities = 38/75 (50%), Positives = 45/75 (60%) Frame = -2 Query: 344 LDRVIPISPRVLPEKLKNQFLLHNNIGSLNFTSQVEPQFGGVLEYSSRGTGLKMRAFKNL 165 L R+IPISPRV L H+NIG LN+ S F G + LKMRA KNL Sbjct: 9 LTRLIPISPRV-------PSLSHSNIGFLNYPSH----FAGT-------SCLKMRASKNL 50 Query: 164 IEDEPVLDWDMRSET 120 IEDEPVLDW +RS++ Sbjct: 51 IEDEPVLDWGLRSDS 65