BLASTX nr result
ID: Angelica27_contig00018037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018037 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017231744.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 1e-31 OMO71681.1 hypothetical protein COLO4_28102 [Corchorus olitorius] 104 2e-24 XP_016476446.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 4e-24 XP_009597258.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 4e-24 KJB51197.1 hypothetical protein B456_008G205900 [Gossypium raimo... 101 2e-23 XP_019249193.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 2e-23 XP_016697484.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 2e-23 XP_012438998.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 2e-23 XP_012830580.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 2e-23 EOY22476.1 Pentatricopeptide repeat superfamily protein [Theobro... 101 3e-23 KZV24876.1 pentatricopeptide repeat-containing protein chloropla... 100 4e-23 KDO52659.1 hypothetical protein CISIN_1g005305mg [Citrus sinensis] 100 4e-23 XP_015385283.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 4e-23 KVI06210.1 Iron/zinc purple acid phosphatase-like C-terminal dom... 100 4e-23 XP_017634724.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 7e-23 XP_006440110.1 hypothetical protein CICLE_v10019093mg [Citrus cl... 100 7e-23 XP_004148701.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 7e-23 XP_007037975.2 PREDICTED: pentatricopeptide repeat-containing pr... 100 1e-22 XP_011083787.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 1e-22 XP_008459324.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 1e-22 >XP_017231744.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Daucus carota subsp. sativus] Length = 698 Score = 124 bits (312), Expect = 1e-31 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NTQ+STPLHLVQSHR+CNDCHNAVKLIAMVTNCEIV+RDASRFHRFQDGKCSCGDYW Sbjct: 642 NTQDSTPLHLVQSHRICNDCHNAVKLIAMVTNCEIVLRDASRFHRFQDGKCSCGDYW 698 >OMO71681.1 hypothetical protein COLO4_28102 [Corchorus olitorius] Length = 702 Score = 104 bits (259), Expect = 2e-24 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT +PL +VQSHR+CNDCHNA+KLIA+VT EIVVRDASRFHRF+DG CSCGDYW Sbjct: 646 NTMNGSPLQIVQSHRICNDCHNAIKLIALVTRREIVVRDASRFHRFKDGSCSCGDYW 702 >XP_016476446.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Nicotiana tabacum] Length = 702 Score = 103 bits (257), Expect = 4e-24 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 +T ST L LVQSHR+CNDCHNA+KLIAM+T EIVVRDASRFHRF+DG CSCGDYW Sbjct: 646 STSSSTSLQLVQSHRICNDCHNAIKLIAMITKREIVVRDASRFHRFKDGTCSCGDYW 702 >XP_009597258.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Nicotiana tomentosiformis] Length = 702 Score = 103 bits (257), Expect = 4e-24 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 +T ST L LVQSHR+CNDCHNA+KLIAM+T EIVVRDASRFHRF+DG CSCGDYW Sbjct: 646 STSSSTSLQLVQSHRICNDCHNAIKLIAMITKREIVVRDASRFHRFKDGTCSCGDYW 702 >KJB51197.1 hypothetical protein B456_008G205900 [Gossypium raimondii] Length = 548 Score = 101 bits (252), Expect = 2e-23 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT + +PL +VQ+HR+CNDCHNA+KLIA+VT EIVVRDASRFH F+DG CSCGDYW Sbjct: 492 NTMKGSPLQIVQNHRICNDCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 548 >XP_019249193.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Nicotiana attenuata] OIS99936.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 702 Score = 101 bits (252), Expect = 2e-23 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 +T ST L LVQSHR+CNDCHNA+KLIAM+T EIVVRDASRFHRF++G CSCGDYW Sbjct: 646 STSSSTSLQLVQSHRICNDCHNAIKLIAMITKREIVVRDASRFHRFKNGTCSCGDYW 702 >XP_016697484.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Gossypium hirsutum] Length = 702 Score = 101 bits (252), Expect = 2e-23 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT + +PL +VQ+HR+CNDCHNA+KLIA+VT EIVVRDASRFH F+DG CSCGDYW Sbjct: 646 NTMKGSPLQIVQNHRICNDCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 702 >XP_012438998.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Gossypium raimondii] KJB51198.1 hypothetical protein B456_008G205900 [Gossypium raimondii] Length = 702 Score = 101 bits (252), Expect = 2e-23 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT + +PL +VQ+HR+CNDCHNA+KLIA+VT EIVVRDASRFH F+DG CSCGDYW Sbjct: 646 NTMKGSPLQIVQNHRICNDCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 702 >XP_012830580.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Erythranthe guttata] EYU43052.1 hypothetical protein MIMGU_mgv1a0021231mg, partial [Erythranthe guttata] Length = 703 Score = 101 bits (252), Expect = 2e-23 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 +T +STPL LVQSHR+CNDCH A+KLI+MV EIVVRDASRFHRF+DG CSCGDYW Sbjct: 647 STPDSTPLQLVQSHRICNDCHGAIKLISMVYGKEIVVRDASRFHRFKDGSCSCGDYW 703 >EOY22476.1 Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 702 Score = 101 bits (251), Expect = 3e-23 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT PL +VQSHR+CNDCHNA+KLIA+VT EIVVRDASRFH F+DG CSCGDYW Sbjct: 646 NTTNGLPLQIVQSHRICNDCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 702 >KZV24876.1 pentatricopeptide repeat-containing protein chloroplastic [Dorcoceras hygrometricum] Length = 703 Score = 100 bits (250), Expect = 4e-23 Identities = 43/57 (75%), Positives = 49/57 (85%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT STPL LVQSHR+CNDCHNA+KLI++V+ EIV RD SRFHRF+DG CSCGDYW Sbjct: 647 NTPSSTPLQLVQSHRICNDCHNAIKLISLVSKREIVFRDCSRFHRFKDGGCSCGDYW 703 >KDO52659.1 hypothetical protein CISIN_1g005305mg [Citrus sinensis] Length = 703 Score = 100 bits (250), Expect = 4e-23 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT + TPL +VQSHR+C DCHNA+KLIAMVT EIVVRDASRFH F+DG CSCGDYW Sbjct: 647 NTSDWTPLQIVQSHRICCDCHNAIKLIAMVTGREIVVRDASRFHHFKDGMCSCGDYW 703 >XP_015385283.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Citrus sinensis] Length = 703 Score = 100 bits (250), Expect = 4e-23 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT + TPL +VQSHR+C DCHNA+KLIAMVT EIVVRDASRFH F+DG CSCGDYW Sbjct: 647 NTSDWTPLQIVQSHRICCDCHNAIKLIAMVTGREIVVRDASRFHHFKDGMCSCGDYW 703 >KVI06210.1 Iron/zinc purple acid phosphatase-like C-terminal domain-containing protein [Cynara cardunculus var. scolymus] Length = 1346 Score = 100 bits (250), Expect = 4e-23 Identities = 46/57 (80%), Positives = 48/57 (84%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT S PLHLVQSHR+C+DCH AVKLIA VT IVVRDASRFHRF DGKCSCGDYW Sbjct: 645 NTAHSMPLHLVQSHRICDDCHLAVKLIAKVTGRVIVVRDASRFHRFADGKCSCGDYW 701 >XP_017634724.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Gossypium arboreum] Length = 702 Score = 100 bits (248), Expect = 7e-23 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT + +PL + Q+HR+CNDCHNA+KLIA+VT EIVVRDASRFH F+DG CSCGDYW Sbjct: 646 NTMKGSPLQIAQNHRICNDCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 702 >XP_006440110.1 hypothetical protein CICLE_v10019093mg [Citrus clementina] ESR53350.1 hypothetical protein CICLE_v10019093mg [Citrus clementina] Length = 703 Score = 100 bits (248), Expect = 7e-23 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT + TPL +VQSHR+C DCHNA+KLIAMVT EIVVRDASRFH F+DG CSCGDYW Sbjct: 647 NTSDWTPLQIVQSHRICCDCHNAIKLIAMVTGREIVVRDASRFHHFKDGICSCGDYW 703 >XP_004148701.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Cucumis sativus] KGN52466.1 hypothetical protein Csa_5G636580 [Cucumis sativus] Length = 706 Score = 100 bits (248), Expect = 7e-23 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT E TPL +VQSHR+C+DCH+ +KLIAM+T EIV+RDASRFH F+DG CSCGDYW Sbjct: 650 NTLEKTPLQIVQSHRICSDCHSVIKLIAMITKREIVIRDASRFHHFRDGSCSCGDYW 706 >XP_007037975.2 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Theobroma cacao] Length = 702 Score = 99.8 bits (247), Expect = 1e-22 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT PL +VQSH++CNDCHNA+KLIA+VT EIVVRDASRFH F+DG CSCGDYW Sbjct: 646 NTTNGLPLQIVQSHQICNDCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 702 >XP_011083787.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Sesamum indicum] XP_011083802.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Sesamum indicum] XP_011083816.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Sesamum indicum] XP_011083824.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Sesamum indicum] Length = 703 Score = 99.8 bits (247), Expect = 1e-22 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT TPL LVQSHR+CNDCHNA+KLI+MV EIV RDASRFHRF++G CSCGDYW Sbjct: 647 NTPSLTPLQLVQSHRICNDCHNAIKLISMVCRREIVFRDASRFHRFKEGSCSCGDYW 703 >XP_008459324.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Cucumis melo] XP_008459325.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Cucumis melo] Length = 704 Score = 99.8 bits (247), Expect = 1e-22 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = -1 Query: 232 NTQESTPLHLVQSHRMCNDCHNAVKLIAMVTNCEIVVRDASRFHRFQDGKCSCGDYW 62 NT E TPL +VQSHR+C+DCH+ +KLIAM+T EIV+RDASRFH F+DG CSCGDYW Sbjct: 648 NTLERTPLQIVQSHRICSDCHSVIKLIAMITKREIVIRDASRFHHFRDGNCSCGDYW 704