BLASTX nr result
ID: Angelica27_contig00017979
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00017979 (657 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237544.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-08 KZN01773.1 hypothetical protein DCAR_010527 [Daucus carota subsp... 65 1e-08 >XP_017237544.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Daucus carota subsp. sativus] Length = 514 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +1 Query: 205 EVPLIYKEMESVGRTPDRKGRELLQTALMVIEKPQI 312 +VPLIYKEMES G TPDRK RELLQTALMVIEKPQI Sbjct: 479 KVPLIYKEMESAGCTPDRKARELLQTALMVIEKPQI 514 >KZN01773.1 hypothetical protein DCAR_010527 [Daucus carota subsp. sativus] Length = 719 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +1 Query: 205 EVPLIYKEMESVGRTPDRKGRELLQTALMVIEKPQI 312 +VPLIYKEMES G TPDRK RELLQTALMVIEKPQI Sbjct: 684 KVPLIYKEMESAGCTPDRKARELLQTALMVIEKPQI 719