BLASTX nr result
ID: Angelica27_contig00016947
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00016947 (623 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247615.1 PREDICTED: serine/threonine-protein kinase D6PK-l... 100 9e-21 XP_010251076.1 PREDICTED: serine/threonine-protein kinase D6PKL1... 83 7e-15 XP_019246076.1 PREDICTED: protein kinase PVPK-1-like [Nicotiana ... 79 1e-13 XP_016473816.1 PREDICTED: protein kinase PVPK-1-like [Nicotiana ... 79 1e-13 XP_009615256.1 PREDICTED: protein kinase PVPK-1-like [Nicotiana ... 79 1e-13 XP_016561616.1 PREDICTED: protein kinase PVPK-1 [Capsicum annuum] 77 9e-13 CDP02058.1 unnamed protein product [Coffea canephora] 76 1e-12 XP_002272711.2 PREDICTED: protein kinase PVPK-1 [Vitis vinifera]... 76 2e-12 XP_010248634.1 PREDICTED: serine/threonine-protein kinase D6PK-l... 76 2e-12 XP_009603203.1 PREDICTED: serine/threonine-protein kinase D6PKL1... 75 2e-12 XP_009793786.1 PREDICTED: serine/threonine-protein kinase D6PK-l... 75 3e-12 OAY29517.1 hypothetical protein MANES_15G151100 [Manihot esculen... 75 3e-12 XP_007031590.2 PREDICTED: protein kinase PVPK-1 [Theobroma cacao... 75 4e-12 EOY02515.1 D6 protein kinase like 2 isoform 1 [Theobroma cacao] ... 75 4e-12 XP_017259193.1 PREDICTED: protein kinase PVPK-1 [Daucus carota s... 74 7e-12 XP_015162966.1 PREDICTED: serine/threonine-protein kinase D6PK [... 72 2e-11 XP_019226507.1 PREDICTED: serine/threonine-protein kinase D6PK-l... 72 2e-11 XP_015065841.1 PREDICTED: serine/threonine-protein kinase D6PK-l... 72 3e-11 XP_004231848.1 PREDICTED: serine/threonine-protein kinase D6PK [... 72 3e-11 XP_018811384.1 PREDICTED: protein kinase PVPK-1-like [Juglans re... 72 3e-11 >XP_017247615.1 PREDICTED: serine/threonine-protein kinase D6PK-like [Daucus carota subsp. sativus] XP_017247616.1 PREDICTED: serine/threonine-protein kinase D6PK-like [Daucus carota subsp. sativus] KZM97575.1 hypothetical protein DCAR_015063 [Daucus carota subsp. sativus] Length = 628 Score = 99.8 bits (247), Expect = 9e-21 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVPRP++YNEVP+AP VDKVPGVDVKPSGNYLEIDFF Sbjct: 582 WALIRCASPPDVPRPFLYNEVPRAPKVDKVPGVDVKPSGNYLEIDFF 628 >XP_010251076.1 PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo nucifera] XP_010251077.1 PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo nucifera] XP_010251078.1 PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo nucifera] Length = 713 Score = 82.8 bits (203), Expect = 7e-15 Identities = 38/52 (73%), Positives = 44/52 (84%), Gaps = 5/52 (9%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYN-----EVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVP+P++ + EVPKAP +K+PGVDVKPSGNYLEIDFF Sbjct: 662 WALIRCASPPDVPKPFVIDFPTRTEVPKAPTNEKMPGVDVKPSGNYLEIDFF 713 >XP_019246076.1 PREDICTED: protein kinase PVPK-1-like [Nicotiana attenuata] OIT03729.1 protein kinase pvpk-1 [Nicotiana attenuata] Length = 655 Score = 79.0 bits (193), Expect = 1e-13 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVPRP M ++P+ P KV GVDVKPSGNY EIDFF Sbjct: 609 WALIRCASPPDVPRPCMTYDMPRTPPAGKVAGVDVKPSGNYFEIDFF 655 >XP_016473816.1 PREDICTED: protein kinase PVPK-1-like [Nicotiana tabacum] XP_016473817.1 PREDICTED: protein kinase PVPK-1-like [Nicotiana tabacum] Length = 655 Score = 79.0 bits (193), Expect = 1e-13 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVPRP M ++P+ P KV GVDVKPSGNY EIDFF Sbjct: 609 WALIRCASPPDVPRPCMTYDMPRTPPAGKVAGVDVKPSGNYFEIDFF 655 >XP_009615256.1 PREDICTED: protein kinase PVPK-1-like [Nicotiana tomentosiformis] XP_009615257.1 PREDICTED: protein kinase PVPK-1-like [Nicotiana tomentosiformis] Length = 655 Score = 79.0 bits (193), Expect = 1e-13 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVPRP M ++P+ P KV GVDVKPSGNY EIDFF Sbjct: 609 WALIRCASPPDVPRPCMTYDMPRTPPAGKVAGVDVKPSGNYFEIDFF 655 >XP_016561616.1 PREDICTED: protein kinase PVPK-1 [Capsicum annuum] Length = 602 Score = 76.6 bits (187), Expect = 9e-13 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVP+P M ++P+ P K PG DVKPSGNY EIDFF Sbjct: 556 WALIRCASPPDVPKPSMTYDMPRTPPAGKTPGGDVKPSGNYFEIDFF 602 >CDP02058.1 unnamed protein product [Coffea canephora] Length = 675 Score = 76.3 bits (186), Expect = 1e-12 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVP+P+ +++ + P D VPGVDVKPSGNYLEIDFF Sbjct: 630 WALIRCASPPDVPKPFPIDDILRVPKPD-VPGVDVKPSGNYLEIDFF 675 >XP_002272711.2 PREDICTED: protein kinase PVPK-1 [Vitis vinifera] XP_019080718.1 PREDICTED: protein kinase PVPK-1 [Vitis vinifera] Length = 683 Score = 75.9 bits (185), Expect = 2e-12 Identities = 34/52 (65%), Positives = 40/52 (76%), Gaps = 5/52 (9%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYN-----EVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRC +PPD+P+P+M + + KAP KVPGVDVKPSGNYLEIDFF Sbjct: 632 WALIRCTNPPDMPKPFMIDFSARSDTTKAPTAGKVPGVDVKPSGNYLEIDFF 683 >XP_010248634.1 PREDICTED: serine/threonine-protein kinase D6PK-like [Nelumbo nucifera] Length = 710 Score = 75.9 bits (185), Expect = 2e-12 Identities = 35/52 (67%), Positives = 42/52 (80%), Gaps = 5/52 (9%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYN-----EVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRC SPP+VP+P+M + EVPKA DK+PG+D+KPSGNYLEIDFF Sbjct: 659 WALIRCTSPPEVPKPFMMDLPTTTEVPKALANDKMPGMDMKPSGNYLEIDFF 710 >XP_009603203.1 PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nicotiana tomentosiformis] XP_016450582.1 PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nicotiana tabacum] XP_016450588.1 PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nicotiana tabacum] Length = 659 Score = 75.5 bits (184), Expect = 2e-12 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVP+P++ ++VP AP KVPG DVKP+ NY EIDFF Sbjct: 614 WALIRCASPPDVPKPFVLHDVPSAP-ATKVPGADVKPADNYFEIDFF 659 >XP_009793786.1 PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana sylvestris] XP_016507225.1 PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana tabacum] Length = 609 Score = 75.1 bits (183), Expect = 3e-12 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVPRP M ++P+ KV GVDVKPSGNY EIDFF Sbjct: 563 WALIRCASPPDVPRPCMTYDMPRTLPAGKVAGVDVKPSGNYFEIDFF 609 >OAY29517.1 hypothetical protein MANES_15G151100 [Manihot esculenta] OAY29518.1 hypothetical protein MANES_15G151100 [Manihot esculenta] Length = 650 Score = 75.1 bits (183), Expect = 3e-12 Identities = 36/52 (69%), Positives = 40/52 (76%), Gaps = 5/52 (9%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYN-----EVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRC +PP+VPR M + +VPKAP V VPGVDVKPSGNYLEIDFF Sbjct: 599 WALIRCTNPPEVPRHAMMDILMRADVPKAPTVANVPGVDVKPSGNYLEIDFF 650 >XP_007031590.2 PREDICTED: protein kinase PVPK-1 [Theobroma cacao] XP_007031589.2 PREDICTED: protein kinase PVPK-1 [Theobroma cacao] Length = 678 Score = 74.7 bits (182), Expect = 4e-12 Identities = 35/52 (67%), Positives = 41/52 (78%), Gaps = 5/52 (9%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYN-----EVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCA+PP+VP+ M + ++ K PN DKVPGVDVKPSGNYLEIDFF Sbjct: 627 WALIRCANPPEVPKQAMMDFSVRTDMAKVPNNDKVPGVDVKPSGNYLEIDFF 678 >EOY02515.1 D6 protein kinase like 2 isoform 1 [Theobroma cacao] EOY02516.1 D6 protein kinase like 2 isoform 1 [Theobroma cacao] Length = 678 Score = 74.7 bits (182), Expect = 4e-12 Identities = 35/52 (67%), Positives = 41/52 (78%), Gaps = 5/52 (9%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYN-----EVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCA+PP+VP+ M + ++ K PN DKVPGVDVKPSGNYLEIDFF Sbjct: 627 WALIRCANPPEVPKQAMMDFSVRTDMAKVPNNDKVPGVDVKPSGNYLEIDFF 678 >XP_017259193.1 PREDICTED: protein kinase PVPK-1 [Daucus carota subsp. sativus] XP_017259194.1 PREDICTED: protein kinase PVPK-1 [Daucus carota subsp. sativus] XP_017259196.1 PREDICTED: protein kinase PVPK-1 [Daucus carota subsp. sativus] XP_017259197.1 PREDICTED: protein kinase PVPK-1 [Daucus carota subsp. sativus] XP_017259198.1 PREDICTED: protein kinase PVPK-1 [Daucus carota subsp. sativus] XP_017259199.1 PREDICTED: protein kinase PVPK-1 [Daucus carota subsp. sativus] KZM90912.1 hypothetical protein DCAR_021723 [Daucus carota subsp. sativus] Length = 661 Score = 73.9 bits (180), Expect = 7e-12 Identities = 36/49 (73%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKP--SGNYLEIDFF 483 WALIRCASPPDVP+PY EVPK+P V+ V GVD+KP SG+YLEIDFF Sbjct: 614 WALIRCASPPDVPKPYPI-EVPKSPKVENVAGVDMKPSGSGSYLEIDFF 661 >XP_015162966.1 PREDICTED: serine/threonine-protein kinase D6PK [Solanum tuberosum] CAA62476.1 stpk1 protein kinase [Solanum tuberosum] Length = 631 Score = 72.4 bits (176), Expect = 2e-11 Identities = 33/48 (68%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -1 Query: 623 WALIRCASPPDVPRPY-MYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRC SPPDVP+P M +P+ P K PGVDVKPSGNY EIDFF Sbjct: 584 WALIRCTSPPDVPKPSSMTYNMPRTPPAGKTPGVDVKPSGNYFEIDFF 631 >XP_019226507.1 PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana attenuata] OIT31998.1 protein kinase pvpk-1 [Nicotiana attenuata] Length = 649 Score = 72.4 bits (176), Expect = 2e-11 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRCASPPDVP+P++ ++V AP KVPG DVKP+ NY EIDFF Sbjct: 604 WALIRCASPPDVPKPFVLHDVSSAP-ATKVPGADVKPADNYFEIDFF 649 >XP_015065841.1 PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum pennellii] Length = 625 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -1 Query: 623 WALIRCASPPDVPRPY-MYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRC SPPDVP+P M ++P+ P K PG+DVKPSGNY EIDFF Sbjct: 578 WALIRCTSPPDVPKPSSMTYDMPRTPPAGKAPGLDVKPSGNYFEIDFF 625 >XP_004231848.1 PREDICTED: serine/threonine-protein kinase D6PK [Solanum lycopersicum] Length = 625 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -1 Query: 623 WALIRCASPPDVPRPY-MYNEVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRC SPPDVP+P M ++P+ P K PG+DVKPSGNY EIDFF Sbjct: 578 WALIRCTSPPDVPKPSSMTYDMPRTPPAGKAPGLDVKPSGNYFEIDFF 625 >XP_018811384.1 PREDICTED: protein kinase PVPK-1-like [Juglans regia] XP_018811385.1 PREDICTED: protein kinase PVPK-1-like [Juglans regia] Length = 676 Score = 72.0 bits (175), Expect = 3e-11 Identities = 35/52 (67%), Positives = 40/52 (76%), Gaps = 5/52 (9%) Frame = -1 Query: 623 WALIRCASPPDVPRPYMYN-----EVPKAPNVDKVPGVDVKPSGNYLEIDFF 483 WALIRC +PP+VPRP + +VPKAP + VPGVDVKPSGNYLEIDFF Sbjct: 626 WALIRCTNPPEVPRPVAMDIPTRTDVPKAPTTE-VPGVDVKPSGNYLEIDFF 676