BLASTX nr result
ID: Angelica27_contig00016869
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00016869 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017245119.1 PREDICTED: U3 snoRNP-associated protein-like EMB2... 92 3e-19 >XP_017245119.1 PREDICTED: U3 snoRNP-associated protein-like EMB2271 [Daucus carota subsp. sativus] KZN11203.1 hypothetical protein DCAR_003859 [Daucus carota subsp. sativus] Length = 516 Score = 92.0 bits (227), Expect = 3e-19 Identities = 54/90 (60%), Positives = 58/90 (64%), Gaps = 9/90 (10%) Frame = -2 Query: 316 MGKSVKKAPKSS--------GKKRFSIENDTFFDNDKKRRRNFQDDNIESSDEDAY-XXX 164 MGK+ KK PKSS GKKRFSI++DTFFDNDKKRRRNF+DDNIESSDED Y Sbjct: 1 MGKAFKKTPKSSAPTPKPKGGKKRFSIDHDTFFDNDKKRRRNFEDDNIESSDEDDYGELR 60 Query: 163 XXXXXXXXXXXXXXXXXVRKRIAEAHLEKL 74 VRKRIAEAHLEKL Sbjct: 61 VGEEAEQEEEEVETAAEVRKRIAEAHLEKL 90