BLASTX nr result
ID: Angelica27_contig00016851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00016851 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN04860.1 hypothetical protein DCAR_005697 [Daucus carota subsp... 112 5e-26 XP_017236040.1 PREDICTED: autophagy-related protein 9-like [Dauc... 112 5e-26 XP_017230603.1 PREDICTED: autophagy-related protein 9-like [Dauc... 69 6e-11 KVH94273.1 Autophagy-related protein 9 [Cynara cardunculus var. ... 62 1e-08 CDP07994.1 unnamed protein product [Coffea canephora] 57 6e-07 XP_012831350.1 PREDICTED: autophagy-related protein 9 [Erythrant... 55 3e-06 >KZN04860.1 hypothetical protein DCAR_005697 [Daucus carota subsp. sativus] Length = 841 Score = 112 bits (279), Expect = 5e-26 Identities = 53/57 (92%), Positives = 54/57 (94%) Frame = -2 Query: 412 RSIIEEEQDHFELTRSHNRLSRTFFLDDLEGGQFNLPFDDIYSRHSTSPEPDPLNPV 242 RSIIEEEQDH EL RSHNRLSRTF+LDDLEGGQFNLPFDDIYSRHSTSPEPDPLN V Sbjct: 785 RSIIEEEQDHSELIRSHNRLSRTFYLDDLEGGQFNLPFDDIYSRHSTSPEPDPLNLV 841 >XP_017236040.1 PREDICTED: autophagy-related protein 9-like [Daucus carota subsp. sativus] XP_017236041.1 PREDICTED: autophagy-related protein 9-like [Daucus carota subsp. sativus] Length = 856 Score = 112 bits (279), Expect = 5e-26 Identities = 53/57 (92%), Positives = 54/57 (94%) Frame = -2 Query: 412 RSIIEEEQDHFELTRSHNRLSRTFFLDDLEGGQFNLPFDDIYSRHSTSPEPDPLNPV 242 RSIIEEEQDH EL RSHNRLSRTF+LDDLEGGQFNLPFDDIYSRHSTSPEPDPLN V Sbjct: 800 RSIIEEEQDHSELIRSHNRLSRTFYLDDLEGGQFNLPFDDIYSRHSTSPEPDPLNLV 856 >XP_017230603.1 PREDICTED: autophagy-related protein 9-like [Daucus carota subsp. sativus] KZN08393.1 hypothetical protein DCAR_000939 [Daucus carota subsp. sativus] Length = 908 Score = 68.9 bits (167), Expect = 6e-11 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = -2 Query: 409 SIIEEEQDHFELTRSHNRLSRTFFLDDLEGGQFNLPFDDIYSRHSTSPEPDPLN 248 SI++E+QD RS NR S + ++ D++ GQFNLPFDDIYSRHSTSPE DP N Sbjct: 854 SIVQEDQDRSGSMRSSNR-SHSIYIGDIDEGQFNLPFDDIYSRHSTSPELDPSN 906 >KVH94273.1 Autophagy-related protein 9 [Cynara cardunculus var. scolymus] Length = 736 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 400 EEEQDHFELTRSHNRLSRTFFLDDLEGG-QFNLPFDDIYSRHSTSP 266 EEE+D R+ NRLS+TFF+DD+EGG +F+LPFDDIY RHS SP Sbjct: 686 EEEEDQQFDWRASNRLSKTFFMDDVEGGGKFDLPFDDIYDRHSESP 731 >CDP07994.1 unnamed protein product [Coffea canephora] Length = 864 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 397 EEQDHFELTRSHNRLSRTFFLDDLEGGQFNLPFDDIYSRHSTS 269 EEQ+H + R+ +RLSRTF +DD +GG FNLPFDDIY+RHS S Sbjct: 813 EEQEHLDW-RNSSRLSRTFLMDD-DGGNFNLPFDDIYTRHSQS 853 >XP_012831350.1 PREDICTED: autophagy-related protein 9 [Erythranthe guttata] EYU46469.1 hypothetical protein MIMGU_mgv1a001180mg [Erythranthe guttata] Length = 871 Score = 55.5 bits (132), Expect = 3e-06 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 4/61 (6%) Frame = -2 Query: 412 RSIIEEEQDHFELTRSHNRLSRTFFLDDLEGGQFNLPFDDIYSRH----STSPEPDPLNP 245 RS EEE++ +L S LSRTF++DD++GG FNLPF DIY H + DPLN Sbjct: 812 RSEEEEEEEQLDLRNSRG-LSRTFYMDDVDGGDFNLPFVDIYGAHEENANEGENDDPLNI 870 Query: 244 V 242 V Sbjct: 871 V 871