BLASTX nr result
ID: Angelica27_contig00016842
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00016842 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EOX91334.1 Uncharacterized protein TCM_000563 [Theobroma cacao] 64 2e-11 ONH96566.1 hypothetical protein PRUPE_7G137600 [Prunus persica] 59 3e-09 KJB40248.1 hypothetical protein B456_007G053400 [Gossypium raimo... 56 3e-08 CBI18827.3 unnamed protein product, partial [Vitis vinifera] 52 1e-06 KHN42062.1 hypothetical protein glysoja_003802 [Glycine soja] KR... 51 3e-06 XP_007156826.1 hypothetical protein PHAVU_002G021000g [Phaseolus... 50 5e-06 >EOX91334.1 Uncharacterized protein TCM_000563 [Theobroma cacao] Length = 51 Score = 63.9 bits (154), Expect = 2e-11 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -2 Query: 332 MEAPTIQSIDNSRNLPQ--DDQQDKLIDECCCCFYNCWDSCFDYWCC 198 MEAP QSI+ S N Q +D+QDK +DECC C Y+C ++CFDY CC Sbjct: 1 MEAPATQSIETSTNNFQVEEDEQDKAVDECCSCCYDCTETCFDYLCC 47 >ONH96566.1 hypothetical protein PRUPE_7G137600 [Prunus persica] Length = 50 Score = 58.5 bits (140), Expect = 3e-09 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -2 Query: 332 MEAPTIQSIDNSRNLPQ--DDQQDKLIDECCCCFYNCWDSCFDYWCC 198 ME P Q+I+ S N Q +D+QDK+I+ECC CFY+C ++CFDY C Sbjct: 1 MEPPPAQAIETSSNNFQAGEDEQDKVINECCSCFYDCTETCFDYLFC 47 >KJB40248.1 hypothetical protein B456_007G053400 [Gossypium raimondii] Length = 51 Score = 55.8 bits (133), Expect = 3e-08 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = -2 Query: 332 MEAPTIQSIDNSRNLPQ--DDQQDKLIDECCCCFYNCWDSCFDYWCC 198 ME P QSI+ S Q +D+QDK +DECC C Y C S FDY CC Sbjct: 1 MEPPATQSIETSTKSFQVEEDEQDKAVDECCSCCYECTGSIFDYLCC 47 >CBI18827.3 unnamed protein product, partial [Vitis vinifera] Length = 52 Score = 52.0 bits (123), Expect = 1e-06 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 3/48 (6%) Frame = -2 Query: 332 MEAPTIQSIDNSR---NLPQDDQQDKLIDECCCCFYNCWDSCFDYWCC 198 M+ P QSI+ S ++ D+Q+K+ DECC C Y C D+C D++CC Sbjct: 1 MDPPPTQSIEISSKTYDIQGQDEQEKVADECCSCCYACTDNCIDFFCC 48 >KHN42062.1 hypothetical protein glysoja_003802 [Glycine soja] KRH28505.1 hypothetical protein GLYMA_11G058200 [Glycine max] Length = 50 Score = 50.8 bits (120), Expect = 3e-06 Identities = 24/47 (51%), Positives = 30/47 (63%), Gaps = 2/47 (4%) Frame = -2 Query: 332 MEAPTIQSIDNSRNLPQ--DDQQDKLIDECCCCFYNCWDSCFDYWCC 198 ME P QSI+ S + Q DD QDK+I+ECC C Y+C FD+ CC Sbjct: 1 MEPPPSQSIEISGHGYQAGDDTQDKVINECCSCCYDCTQGLFDFLCC 47 >XP_007156826.1 hypothetical protein PHAVU_002G021000g [Phaseolus vulgaris] ESW28820.1 hypothetical protein PHAVU_002G021000g [Phaseolus vulgaris] Length = 44 Score = 50.1 bits (118), Expect = 5e-06 Identities = 22/45 (48%), Positives = 27/45 (60%) Frame = -2 Query: 332 MEAPTIQSIDNSRNLPQDDQQDKLIDECCCCFYNCWDSCFDYWCC 198 ME P QSI + DD QDK+I+ECC C Y+C FD+ CC Sbjct: 1 MEPPPSQSIQ----IAGDDSQDKVINECCSCCYDCTQGLFDFLCC 41