BLASTX nr result
ID: Angelica27_contig00016784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00016784 (229 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU45178.1 hypothetical protein MIMGU_mgv1a0078291mg, partial [E... 54 3e-07 XP_011083899.1 PREDICTED: tubby-like F-box protein 5 [Sesamum in... 55 6e-07 XP_012846703.1 PREDICTED: tubby-like F-box protein 6, partial [E... 54 8e-07 KZV18376.1 hypothetical protein F511_28427 [Dorcoceras hygrometr... 54 1e-06 XP_011007470.1 PREDICTED: tubby-like F-box protein 5 isoform X2 ... 53 3e-06 XP_007222682.1 hypothetical protein PRUPE_ppa006363mg [Prunus pe... 52 4e-06 XP_003544406.1 PREDICTED: tubby-like F-box protein 5 [Glycine ma... 52 4e-06 KHN12701.1 Tubby-like F-box protein 5 [Glycine soja] 52 4e-06 XP_003550385.1 PREDICTED: tubby-like F-box protein 5 isoform X3 ... 52 4e-06 XP_006601317.1 PREDICTED: tubby-like F-box protein 5 isoform X2 ... 52 4e-06 KRH05836.1 hypothetical protein GLYMA_17G251500 [Glycine max] 52 4e-06 XP_006601316.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 52 4e-06 ONK81252.1 uncharacterized protein A4U43_C01F27030 [Asparagus of... 52 5e-06 XP_011007469.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 52 5e-06 GAV77124.1 F-box domain-containing protein/Tub domain-containing... 52 5e-06 KDO84594.1 hypothetical protein CISIN_1g014578mg [Citrus sinensis] 52 5e-06 XP_017644811.1 PREDICTED: tubby-like F-box protein 5 isoform X2 ... 52 7e-06 XP_007017568.2 PREDICTED: tubby-like F-box protein 5 [Theobroma ... 52 7e-06 XP_010254793.1 PREDICTED: tubby-like F-box protein 5 [Nelumbo nu... 52 7e-06 KDO84592.1 hypothetical protein CISIN_1g014578mg [Citrus sinensis] 52 7e-06 >EYU45178.1 hypothetical protein MIMGU_mgv1a0078291mg, partial [Erythranthe guttata] Length = 140 Score = 53.5 bits (127), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER TSTY+LYLGLS Sbjct: 109 SLKQPGPRDSPIQCFIRRERATSTYRLYLGLS 140 >XP_011083899.1 PREDICTED: tubby-like F-box protein 5 [Sesamum indicum] Length = 382 Score = 54.7 bits (130), Expect = 6e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER+TSTY+LYLGLS Sbjct: 115 SLKQPGPRDSPIQCFIRRERETSTYRLYLGLS 146 >XP_012846703.1 PREDICTED: tubby-like F-box protein 6, partial [Erythranthe guttata] Length = 204 Score = 53.5 bits (127), Expect = 8e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER TSTY+LYLGLS Sbjct: 114 SLKQPGPRDSPIQCFIRRERATSTYRLYLGLS 145 >KZV18376.1 hypothetical protein F511_28427 [Dorcoceras hygrometricum] Length = 377 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER TSTY+LYLGLS Sbjct: 115 SLKQPGPRDSPIQCFIRRERSTSTYRLYLGLS 146 >XP_011007470.1 PREDICTED: tubby-like F-box protein 5 isoform X2 [Populus euphratica] Length = 413 Score = 52.8 bits (125), Expect = 3e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLSLDNVQLIL 122 SLKQPG RD+P+Q IRRER TSTY LYLGLS ++ +L Sbjct: 117 SLKQPGPRDAPIQCFIRRERATSTYHLYLGLSPGDMNKLL 156 >XP_007222682.1 hypothetical protein PRUPE_ppa006363mg [Prunus persica] ONI32633.1 hypothetical protein PRUPE_1G377700 [Prunus persica] ONI32634.1 hypothetical protein PRUPE_1G377700 [Prunus persica] Length = 415 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RD+P+Q I+RER+TSTY+LYLGLS Sbjct: 117 SLKQPGPRDAPIQCFIKRERETSTYRLYLGLS 148 >XP_003544406.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] XP_006595928.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] XP_006595929.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] XP_006595930.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] KHN20970.1 Tubby-like F-box protein 5 [Glycine soja] KRH15179.1 hypothetical protein GLYMA_14G073500 [Glycine max] KRH15180.1 hypothetical protein GLYMA_14G073500 [Glycine max] Length = 423 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER TSTY LYLGLS Sbjct: 120 SLKQPGPRDSPIQCFIRRERMTSTYCLYLGLS 151 >KHN12701.1 Tubby-like F-box protein 5 [Glycine soja] Length = 436 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER TSTY LYLGLS Sbjct: 124 SLKQPGPRDSPIQCFIRRERMTSTYCLYLGLS 155 >XP_003550385.1 PREDICTED: tubby-like F-box protein 5 isoform X3 [Glycine max] KRH05839.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 436 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER TSTY LYLGLS Sbjct: 124 SLKQPGPRDSPIQCFIRRERMTSTYCLYLGLS 155 >XP_006601317.1 PREDICTED: tubby-like F-box protein 5 isoform X2 [Glycine max] KRH05838.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 448 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER TSTY LYLGLS Sbjct: 136 SLKQPGPRDSPIQCFIRRERMTSTYCLYLGLS 167 >KRH05836.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 452 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER TSTY LYLGLS Sbjct: 140 SLKQPGPRDSPIQCFIRRERMTSTYCLYLGLS 171 >XP_006601316.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Glycine max] KRH05837.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 454 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RDSP+Q IRRER TSTY LYLGLS Sbjct: 142 SLKQPGPRDSPIQCFIRRERMTSTYCLYLGLS 173 >ONK81252.1 uncharacterized protein A4U43_C01F27030 [Asparagus officinalis] Length = 415 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RD P+Q IRRER TSTYQL+LGLS Sbjct: 113 SLKQPGPRDGPMQCFIRRERATSTYQLFLGLS 144 >XP_011007469.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Populus euphratica] Length = 416 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RD+P+Q IRRER TSTY LYLGLS Sbjct: 117 SLKQPGPRDAPIQCFIRRERATSTYHLYLGLS 148 >GAV77124.1 F-box domain-containing protein/Tub domain-containing protein [Cephalotus follicularis] Length = 417 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RD P+Q IRRER TSTY+LYLGLS Sbjct: 117 SLKQPGPRDGPIQCFIRRERATSTYRLYLGLS 148 >KDO84594.1 hypothetical protein CISIN_1g014578mg [Citrus sinensis] Length = 421 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLSLD 104 SLKQPG RD+P+Q IRRER T TY+LYLGLS D Sbjct: 120 SLKQPGPRDAPIQCYIRRERPTGTYRLYLGLSPD 153 >XP_017644811.1 PREDICTED: tubby-like F-box protein 5 isoform X2 [Gossypium arboreum] Length = 406 Score = 51.6 bits (122), Expect = 7e-06 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLSLDNVQLIL 122 SLKQPG RD+P++ I+RE++TSTY+LY+GLS N+ +L Sbjct: 131 SLKQPGPRDTPIECFIQREKETSTYRLYMGLSPGNLNKLL 170 >XP_007017568.2 PREDICTED: tubby-like F-box protein 5 [Theobroma cacao] Length = 413 Score = 51.6 bits (122), Expect = 7e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLS 98 SLKQPG RD+P+Q IRRER TSTY+LY+GLS Sbjct: 115 SLKQPGPRDTPIQCYIRRERATSTYRLYMGLS 146 >XP_010254793.1 PREDICTED: tubby-like F-box protein 5 [Nelumbo nucifera] Length = 413 Score = 51.6 bits (122), Expect = 7e-06 Identities = 28/44 (63%), Positives = 33/44 (75%), Gaps = 4/44 (9%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLSL----DNVQLIL 122 SLKQPG RDSP+Q IRR+R TSTY+LYLGL DN +L+L Sbjct: 115 SLKQPGPRDSPIQCFIRRDRSTSTYRLYLGLCPAPLGDNNKLLL 158 >KDO84592.1 hypothetical protein CISIN_1g014578mg [Citrus sinensis] Length = 419 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +3 Query: 3 SLKQPGLRDSPLQFSIRRERQTSTYQLYLGLSLDNVQLIL 122 SLKQPG RD+P+Q IRRER T TY+LYLGLS ++ +L Sbjct: 120 SLKQPGPRDAPIQCYIRRERPTGTYRLYLGLSPGDMSKLL 159