BLASTX nr result
ID: Angelica27_contig00016514
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00016514 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABR16805.1 unknown [Picea sitchensis] 58 1e-07 ONK72725.1 uncharacterized protein A4U43_C04F22490 [Asparagus of... 57 2e-07 XP_010666127.1 PREDICTED: ribosome-binding factor PSRP1, chlorop... 57 3e-07 WP_011431240.1 ribosomal subunit interface protein [Synechococcu... 55 4e-07 BAT78921.1 hypothetical protein VIGAN_02168100 [Vigna angularis ... 53 5e-07 AAA34039.1 ribosomal protein 30S subunit [Spinacia oleracea] 55 9e-07 P19954.2 RecName: Full=Ribosome-binding factor PSRP1, chloroplas... 55 9e-07 WP_011434101.1 ribosomal subunit interface protein [Synechococcu... 54 1e-06 XP_002973770.1 hypothetical protein SELMODRAFT_25079, partial [S... 54 1e-06 XP_008347268.1 PREDICTED: ribosome-binding factor PSRP1, chlorop... 54 1e-06 XP_007218778.1 hypothetical protein PRUPE_ppa009612mg [Prunus pe... 55 2e-06 XP_009361284.1 PREDICTED: ribosome-binding factor PSRP1, chlorop... 55 2e-06 XP_008234645.1 PREDICTED: ribosome-binding factor PSRP1, chlorop... 55 2e-06 XP_003602381.2 sigma 54 modulation protein/S30EA ribosomal prote... 55 2e-06 AFK39464.1 unknown [Medicago truncatula] 55 2e-06 ONI25759.1 hypothetical protein PRUPE_2G318800 [Prunus persica] 55 2e-06 XP_002975818.1 hypothetical protein SELMODRAFT_175159 [Selaginel... 54 2e-06 XP_008376813.1 PREDICTED: ribosome-binding factor PSRP1, chlorop... 54 2e-06 XP_010421275.1 PREDICTED: ribosome-binding factor PSRP1, chlorop... 54 2e-06 WP_036530239.1 ribosomal subunit interface protein [Neosynechoco... 54 3e-06 >ABR16805.1 unknown [Picea sitchensis] Length = 321 Score = 57.8 bits (138), Expect = 1e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPK 90 DFY FRN+E+GEVNV+YKRK GGYGLI PK Sbjct: 269 DFYAFRNMESGEVNVLYKRKHGGYGLIVPK 298 >ONK72725.1 uncharacterized protein A4U43_C04F22490 [Asparagus officinalis] Length = 320 Score = 57.4 bits (137), Expect = 2e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKK 93 DFY FRN+E GEVN++YKRK GGYGLI PKK Sbjct: 262 DFYGFRNIETGEVNILYKRKEGGYGLIIPKK 292 >XP_010666127.1 PREDICTED: ribosome-binding factor PSRP1, chloroplastic [Beta vulgaris subsp. vulgaris] KMS96293.1 hypothetical protein BVRB_000070 [Beta vulgaris subsp. vulgaris] Length = 300 Score = 56.6 bits (135), Expect = 3e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGK 108 DFY FRN E GE+N++YKRK GGYGLI PK K+ K Sbjct: 249 DFYAFRNEETGEINILYKRKEGGYGLIIPKDGKTEK 284 >WP_011431240.1 ribosomal subunit interface protein [Synechococcus sp. JA-3-3Ab] ABD00567.1 ribosomal subunit interface protein [Synechococcus sp. JA-3-3Ab] Length = 191 Score = 55.5 bits (132), Expect = 4e-07 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAP 87 DFYVFRN+ENGE+NV+Y RK GGYGLI P Sbjct: 161 DFYVFRNIENGEINVIYVRKHGGYGLIRP 189 >BAT78921.1 hypothetical protein VIGAN_02168100 [Vigna angularis var. angularis] Length = 71 Score = 52.8 bits (125), Expect = 5e-07 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPK 90 DFY FRN E GE+N++YKRK GGYGLI PK Sbjct: 19 DFYGFRNEETGEINIVYKRKEGGYGLIIPK 48 >AAA34039.1 ribosomal protein 30S subunit [Spinacia oleracea] Length = 302 Score = 55.5 bits (132), Expect = 9e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGK 108 DFY FRN E G++N++YKRK GGYGLI PK K+ K Sbjct: 251 DFYAFRNEETGDINILYKRKEGGYGLIIPKDGKTEK 286 >P19954.2 RecName: Full=Ribosome-binding factor PSRP1, chloroplastic; AltName: Full=30S ribosomal protein 1; AltName: Full=CS-S5; Short=CS5; AltName: Full=Plastid-specific 30S ribosomal protein 1; Short=PSrp-1; AltName: Full=Ribosomal protein 1; AltName: Full=S22; Flags: Precursor 5MMJ_YY Chain y, Structure Of The Small Subunit Of The Chloroplast Ribosome CAA41960.1 chloroplast ribosomal protein S22 (chloroplast) [Spinacia oleracea] CAA33403.1 spinach S22 r-protein [Spinacia oleracea] KNA06792.1 hypothetical protein SOVF_177810 [Spinacia oleracea] Length = 302 Score = 55.5 bits (132), Expect = 9e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGK 108 DFY FRN E G++N++YKRK GGYGLI PK K+ K Sbjct: 251 DFYAFRNEETGDINILYKRKEGGYGLIIPKDGKTEK 286 >WP_011434101.1 ribosomal subunit interface protein [Synechococcus sp. JA-2-3B'a(2-13)] ABD03474.1 ribosomal subunit interface protein [Synechococcus sp. JA-2-3B'a(2-13)] Length = 190 Score = 54.3 bits (129), Expect = 1e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPK 90 DFYVFRN+ENGE+NV+Y R GGYGLI P+ Sbjct: 161 DFYVFRNIENGEINVIYVRNHGGYGLIRPR 190 >XP_002973770.1 hypothetical protein SELMODRAFT_25079, partial [Selaginella moellendorffii] EFJ25430.1 hypothetical protein SELMODRAFT_25079, partial [Selaginella moellendorffii] Length = 205 Score = 54.3 bits (129), Expect = 1e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKK 93 DFY FRN E+GEVN++YKRK GGYG+I P++ Sbjct: 175 DFYAFRNAESGEVNILYKRKEGGYGIIIPRE 205 >XP_008347268.1 PREDICTED: ribosome-binding factor PSRP1, chloroplastic-like [Malus domestica] Length = 214 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGKE*KCRH 126 DFY FRN E GE+NV+YKR+ GGYGLI PK +GK K H Sbjct: 162 DFYAFRNEETGEINVIYKREEGGYGLIIPK--GNGKAEKSEH 201 >XP_007218778.1 hypothetical protein PRUPE_ppa009612mg [Prunus persica] Length = 285 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGKE*KCRH 126 DFY FRN E GE+N++YKRK GGYGLI PK +GK K H Sbjct: 233 DFYAFRNEETGEINIIYKRKEGGYGLIIPK--GNGKAEKSGH 272 >XP_009361284.1 PREDICTED: ribosome-binding factor PSRP1, chloroplastic [Pyrus x bretschneideri] Length = 295 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGKE*KCRH 126 DFY FRN E GE+NV+YKR+ GGYGLI PK +GK K +H Sbjct: 243 DFYAFRNEETGEINVIYKREEGGYGLIIPK--GNGKAEKSQH 282 >XP_008234645.1 PREDICTED: ribosome-binding factor PSRP1, chloroplastic isoform X2 [Prunus mume] Length = 314 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGKE*KCRH 126 DFY FRN E GE+N++YKRK GGYGLI PK +GK K H Sbjct: 262 DFYAFRNEETGEINIIYKRKEGGYGLIIPK--GNGKAEKSGH 301 >XP_003602381.2 sigma 54 modulation protein/S30EA ribosomal protein [Medicago truncatula] AES72632.2 sigma 54 modulation protein/S30EA ribosomal protein [Medicago truncatula] Length = 353 Score = 54.7 bits (130), Expect = 2e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPK 90 DFY FRN E+GEVN++YKRK GGYGLI PK Sbjct: 301 DFYAFRNEESGEVNIVYKRKEGGYGLIIPK 330 >AFK39464.1 unknown [Medicago truncatula] Length = 353 Score = 54.7 bits (130), Expect = 2e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPK 90 DFY FRN E+GEVN++YKRK GGYGLI PK Sbjct: 301 DFYAFRNEESGEVNIVYKRKEGGYGLIIPK 330 >ONI25759.1 hypothetical protein PRUPE_2G318800 [Prunus persica] Length = 417 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGKE*KCRH 126 DFY FRN E GE+N++YKRK GGYGLI PK +GK K H Sbjct: 365 DFYAFRNEETGEINIIYKRKEGGYGLIIPK--GNGKAEKSGH 404 >XP_002975818.1 hypothetical protein SELMODRAFT_175159 [Selaginella moellendorffii] EFJ23447.1 hypothetical protein SELMODRAFT_175159 [Selaginella moellendorffii] Length = 259 Score = 54.3 bits (129), Expect = 2e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKK 93 DFY FRN E+GEVN++YKRK GGYG+I P++ Sbjct: 216 DFYAFRNAESGEVNILYKRKEGGYGIIIPRE 246 >XP_008376813.1 PREDICTED: ribosome-binding factor PSRP1, chloroplastic [Malus domestica] Length = 293 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGKE*KCRH 126 DFY FRN E GE+NV+YKR+ GGYGLI PK +GK K H Sbjct: 241 DFYAFRNEETGEINVIYKREEGGYGLIIPK--GNGKAEKSEH 280 >XP_010421275.1 PREDICTED: ribosome-binding factor PSRP1, chloroplastic [Camelina sativa] Length = 306 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGKE 111 DFY F+N E GE+N++YKRK GGYGLI PKK K+ Sbjct: 254 DFYGFQNEETGEINIVYKRKEGGYGLIIPKKDGKAKK 290 >WP_036530239.1 ribosomal subunit interface protein [Neosynechococcus sphagnicola] KGF74037.1 Light-repressed protein A [Neosynechococcus sphagnicola sy1] Length = 211 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = +1 Query: 1 DFYVFRNLENGEVNVMYKRKRGGYGLIAPKKPKSGKE*K 117 DFY+FRN+E GE+NV+Y+R GGYG+I P+ GK K Sbjct: 158 DFYMFRNMETGEINVIYERNHGGYGVIQPRNGVHGKNGK 196