BLASTX nr result
ID: Angelica27_contig00016430
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00016430 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK93411.1 unknown [Populus trichocarpa] 64 8e-10 XP_016507624.1 PREDICTED: villin-4-like [Nicotiana tabacum] 64 8e-10 XP_006372075.1 hypothetical protein POPTR_0018s09690g [Populus t... 64 9e-10 XP_011043930.1 PREDICTED: villin-4-like [Populus euphratica] XP_... 64 9e-10 XP_002324461.1 Villin 4 family protein [Populus trichocarpa] EEF... 64 9e-10 XP_019224211.1 PREDICTED: villin-4-like [Nicotiana attenuata] OI... 64 9e-10 XP_016446197.1 PREDICTED: villin-4-like [Nicotiana tabacum] XP_0... 64 9e-10 XP_009790195.1 PREDICTED: villin-4-like [Nicotiana sylvestris] X... 64 9e-10 XP_009624205.1 PREDICTED: villin-4-like [Nicotiana tomentosiform... 64 9e-10 EEF29018.1 villin 1-4, putative [Ricinus communis] 62 2e-09 XP_012075141.1 PREDICTED: villin-4-like [Jatropha curcas] KDP354... 63 2e-09 XP_017258157.1 PREDICTED: villin-4 [Daucus carota subsp. sativus] 63 2e-09 XP_016557970.1 PREDICTED: villin-4-like isoform X2 [Capsicum ann... 63 2e-09 XP_016557969.1 PREDICTED: villin-4-like isoform X1 [Capsicum ann... 63 2e-09 KZM92499.1 hypothetical protein DCAR_020136 [Daucus carota subsp... 63 2e-09 OAY46716.1 hypothetical protein MANES_06G021400 [Manihot esculenta] 62 4e-09 XP_011012988.1 PREDICTED: villin-4-like [Populus euphratica] XP_... 62 4e-09 XP_008453585.2 PREDICTED: LOW QUALITY PROTEIN: villin-4 [Cucumis... 62 4e-09 XP_004146329.1 PREDICTED: villin-4-like [Cucumis sativus] XP_011... 62 4e-09 XP_006453314.1 hypothetical protein CICLE_v10007360mg [Citrus cl... 62 4e-09 >ABK93411.1 unknown [Populus trichocarpa] Length = 376 Score = 63.9 bits (154), Expect = 8e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMALQLF Sbjct: 347 FREKFGMAKDAFYKLPKWKQNKLKMALQLF 376 >XP_016507624.1 PREDICTED: villin-4-like [Nicotiana tabacum] Length = 389 Score = 63.9 bits (154), Expect = 8e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMALQLF Sbjct: 360 FREKFGMAKDAFYKLPKWKQNKLKMALQLF 389 >XP_006372075.1 hypothetical protein POPTR_0018s09690g [Populus trichocarpa] ERP49872.1 hypothetical protein POPTR_0018s09690g [Populus trichocarpa] Length = 951 Score = 63.9 bits (154), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMALQLF Sbjct: 922 FREKFGMAKDAFYKLPKWKQNKLKMALQLF 951 >XP_011043930.1 PREDICTED: villin-4-like [Populus euphratica] XP_011043931.1 PREDICTED: villin-4-like [Populus euphratica] XP_011043932.1 PREDICTED: villin-4-like [Populus euphratica] Length = 960 Score = 63.9 bits (154), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMALQLF Sbjct: 931 FREKFGMAKDAFYKLPKWKQNKLKMALQLF 960 >XP_002324461.1 Villin 4 family protein [Populus trichocarpa] EEF03026.1 Villin 4 family protein [Populus trichocarpa] Length = 961 Score = 63.9 bits (154), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMALQLF Sbjct: 932 FREKFGMAKDAFYKLPKWKQNKLKMALQLF 961 >XP_019224211.1 PREDICTED: villin-4-like [Nicotiana attenuata] OIT33520.1 villin-4 [Nicotiana attenuata] Length = 973 Score = 63.9 bits (154), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMALQLF Sbjct: 944 FREKFGMAKDAFYKLPKWKQNKLKMALQLF 973 >XP_016446197.1 PREDICTED: villin-4-like [Nicotiana tabacum] XP_016446198.1 PREDICTED: villin-4-like [Nicotiana tabacum] Length = 973 Score = 63.9 bits (154), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMALQLF Sbjct: 944 FREKFGMAKDAFYKLPKWKQNKLKMALQLF 973 >XP_009790195.1 PREDICTED: villin-4-like [Nicotiana sylvestris] XP_009790196.1 PREDICTED: villin-4-like [Nicotiana sylvestris] XP_009790197.1 PREDICTED: villin-4-like [Nicotiana sylvestris] Length = 973 Score = 63.9 bits (154), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMALQLF Sbjct: 944 FREKFGMAKDAFYKLPKWKQNKLKMALQLF 973 >XP_009624205.1 PREDICTED: villin-4-like [Nicotiana tomentosiformis] XP_009624206.1 PREDICTED: villin-4-like [Nicotiana tomentosiformis] XP_009624207.1 PREDICTED: villin-4-like [Nicotiana tomentosiformis] XP_009624208.1 PREDICTED: villin-4-like [Nicotiana tomentosiformis] Length = 973 Score = 63.9 bits (154), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMALQLF Sbjct: 944 FREKFGMAKDAFYKLPKWKQNKLKMALQLF 973 >EEF29018.1 villin 1-4, putative [Ricinus communis] Length = 196 Score = 61.6 bits (148), Expect = 2e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGM K AFYK+PKWKQNKLKMALQLF Sbjct: 167 FREKFGMTKDAFYKMPKWKQNKLKMALQLF 196 >XP_012075141.1 PREDICTED: villin-4-like [Jatropha curcas] KDP35406.1 hypothetical protein JCGZ_10390 [Jatropha curcas] Length = 968 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYK+PKWKQNKLKMALQLF Sbjct: 939 FREKFGMAKDAFYKMPKWKQNKLKMALQLF 968 >XP_017258157.1 PREDICTED: villin-4 [Daucus carota subsp. sativus] Length = 958 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGM KS+FYKLPKWKQNKLKMALQLF Sbjct: 929 FREKFGMTKSSFYKLPKWKQNKLKMALQLF 958 >XP_016557970.1 PREDICTED: villin-4-like isoform X2 [Capsicum annuum] Length = 974 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGM+K AFYKLPKWKQNKLKMALQLF Sbjct: 945 FREKFGMSKEAFYKLPKWKQNKLKMALQLF 974 >XP_016557969.1 PREDICTED: villin-4-like isoform X1 [Capsicum annuum] Length = 978 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGM+K AFYKLPKWKQNKLKMALQLF Sbjct: 949 FREKFGMSKEAFYKLPKWKQNKLKMALQLF 978 >KZM92499.1 hypothetical protein DCAR_020136 [Daucus carota subsp. sativus] Length = 980 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGM KS+FYKLPKWKQNKLKMALQLF Sbjct: 951 FREKFGMTKSSFYKLPKWKQNKLKMALQLF 980 >OAY46716.1 hypothetical protein MANES_06G021400 [Manihot esculenta] Length = 447 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 F+EKFGMAK AFYK+PKWKQNKLKMALQLF Sbjct: 418 FKEKFGMAKDAFYKMPKWKQNKLKMALQLF 447 >XP_011012988.1 PREDICTED: villin-4-like [Populus euphratica] XP_011012989.1 PREDICTED: villin-4-like [Populus euphratica] Length = 960 Score = 62.0 bits (149), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMAL+LF Sbjct: 931 FREKFGMAKYAFYKLPKWKQNKLKMALELF 960 >XP_008453585.2 PREDICTED: LOW QUALITY PROTEIN: villin-4 [Cucumis melo] Length = 961 Score = 62.0 bits (149), Expect = 4e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMAL LF Sbjct: 932 FREKFGMAKDAFYKLPKWKQNKLKMALHLF 961 >XP_004146329.1 PREDICTED: villin-4-like [Cucumis sativus] XP_011656914.1 PREDICTED: villin-4-like [Cucumis sativus] XP_011656919.1 PREDICTED: villin-4-like [Cucumis sativus] KGN65472.1 hypothetical protein Csa_1G423300 [Cucumis sativus] Length = 962 Score = 62.0 bits (149), Expect = 4e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGMAK AFYKLPKWKQNKLKMAL LF Sbjct: 933 FREKFGMAKDAFYKLPKWKQNKLKMALHLF 962 >XP_006453314.1 hypothetical protein CICLE_v10007360mg [Citrus clementina] XP_006453315.1 hypothetical protein CICLE_v10007360mg [Citrus clementina] XP_006453316.1 hypothetical protein CICLE_v10007360mg [Citrus clementina] XP_006474218.1 PREDICTED: villin-4 [Citrus sinensis] XP_006474219.1 PREDICTED: villin-4 [Citrus sinensis] XP_015384548.1 PREDICTED: villin-4 [Citrus sinensis] ESR66554.1 hypothetical protein CICLE_v10007360mg [Citrus clementina] ESR66555.1 hypothetical protein CICLE_v10007360mg [Citrus clementina] ESR66556.1 hypothetical protein CICLE_v10007360mg [Citrus clementina] Length = 963 Score = 62.0 bits (149), Expect = 4e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 FREKFGMAKSAFYKLPKWKQNKLKMALQLF 90 FREKFGM K AFYKLPKWKQNKLKMALQLF Sbjct: 934 FREKFGMKKDAFYKLPKWKQNKLKMALQLF 963