BLASTX nr result
ID: Angelica27_contig00016098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00016098 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017220597.1 PREDICTED: repetitive proline-rich cell wall prot... 75 6e-14 XP_006355521.2 PREDICTED: 36.4 kDa proline-rich protein, partial... 73 3e-13 JAT45782.1 36. proline-rich protein, partial [Anthurium amnicola] 70 3e-13 XP_009595816.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotia... 73 4e-13 XP_004245751.1 PREDICTED: 36.4 kDa proline-rich protein [Solanum... 73 5e-13 XP_016569199.1 PREDICTED: 36.4 kDa proline-rich protein [Capsicu... 73 6e-13 XP_019234659.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotia... 73 6e-13 XP_015084512.1 PREDICTED: 36.4 kDa proline-rich protein [Solanum... 73 7e-13 XP_016501571.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotia... 73 7e-13 XP_009759781.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotia... 73 7e-13 XP_012845873.1 PREDICTED: 36.4 kDa proline-rich protein [Erythra... 71 8e-13 EYU30299.1 hypothetical protein MIMGU_mgv11b015559mg, partial [E... 71 9e-13 XP_015900247.1 PREDICTED: 36.4 kDa proline-rich protein-like [Zi... 71 1e-12 KZN04104.1 hypothetical protein DCAR_004941 [Daucus carota subsp... 72 1e-12 KZV37036.1 36.4 kDa proline-rich protein [Dorcoceras hygrometricum] 72 1e-12 KDO61487.1 hypothetical protein CISIN_1g026333mg [Citrus sinensis] 71 1e-12 XP_006477233.1 PREDICTED: 36.4 kDa proline-rich protein [Citrus ... 71 1e-12 XP_017231866.1 PREDICTED: repetitive proline-rich cell wall prot... 72 1e-12 XP_006440348.1 hypothetical protein CICLE_v10021835mg [Citrus cl... 71 1e-12 XP_009333634.1 PREDICTED: 36.4 kDa proline-rich protein-like [Py... 71 1e-12 >XP_017220597.1 PREDICTED: repetitive proline-rich cell wall protein 1 [Daucus carota subsp. sativus] KZM84788.1 hypothetical protein DCAR_027790 [Daucus carota subsp. sativus] Length = 275 Score = 75.1 bits (183), Expect = 6e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAAVCLCTTIRLKLLNLNIF+PLALSV+ATCGKT Sbjct: 227 LLELEAAVCLCTTIRLKLLNLNIFLPLALSVIATCGKT 264 >XP_006355521.2 PREDICTED: 36.4 kDa proline-rich protein, partial [Solanum tuberosum] Length = 236 Score = 72.8 bits (177), Expect = 3e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLALSVLATCG T Sbjct: 188 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLT 225 >JAT45782.1 36. proline-rich protein, partial [Anthurium amnicola] Length = 122 Score = 70.1 bits (170), Expect = 3e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAAVCLCTTI+LKLLNL+IFIP+AL +LATCGKT Sbjct: 76 LLELEAAVCLCTTIKLKLLNLDIFIPIALKLLATCGKT 113 >XP_009595816.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotiana tomentosiformis] XP_016483181.1 PREDICTED: 36.4 kDa proline-rich protein-like [Nicotiana tabacum] Length = 260 Score = 72.8 bits (177), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLALSVLATCG T Sbjct: 212 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLT 249 >XP_004245751.1 PREDICTED: 36.4 kDa proline-rich protein [Solanum lycopersicum] Length = 292 Score = 72.8 bits (177), Expect = 5e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLALSVLATCG T Sbjct: 244 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLT 281 >XP_016569199.1 PREDICTED: 36.4 kDa proline-rich protein [Capsicum annuum] Length = 308 Score = 72.8 bits (177), Expect = 6e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLALSVLATCG T Sbjct: 260 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLT 297 >XP_019234659.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotiana attenuata] Length = 315 Score = 72.8 bits (177), Expect = 6e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLALSVLATCG T Sbjct: 267 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLT 304 >XP_015084512.1 PREDICTED: 36.4 kDa proline-rich protein [Solanum pennellii] Length = 316 Score = 72.8 bits (177), Expect = 7e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLALSVLATCG T Sbjct: 268 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLT 305 >XP_016501571.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotiana tabacum] Length = 323 Score = 72.8 bits (177), Expect = 7e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLALSVLATCG T Sbjct: 275 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLT 312 >XP_009759781.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotiana sylvestris] Length = 323 Score = 72.8 bits (177), Expect = 7e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLALSVLATCG T Sbjct: 275 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLT 312 >XP_012845873.1 PREDICTED: 36.4 kDa proline-rich protein [Erythranthe guttata] Length = 217 Score = 71.2 bits (173), Expect = 8e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLAL VLATCG T Sbjct: 169 LLELEAAICLCTTIRLKLLNLNIFLPLALQVLATCGLT 206 >EYU30299.1 hypothetical protein MIMGU_mgv11b015559mg, partial [Erythranthe guttata] Length = 226 Score = 71.2 bits (173), Expect = 9e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIF+PLAL VLATCG T Sbjct: 101 LLELEAAICLCTTIRLKLLNLNIFLPLALQVLATCGLT 138 >XP_015900247.1 PREDICTED: 36.4 kDa proline-rich protein-like [Ziziphus jujuba] Length = 237 Score = 71.2 bits (173), Expect = 1e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIFIPLAL L TCGKT Sbjct: 190 LLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGKT 227 >KZN04104.1 hypothetical protein DCAR_004941 [Daucus carota subsp. sativus] Length = 298 Score = 72.0 bits (175), Expect = 1e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAAVCLCTTIRLKLLN+NI++PLALSVL TCGKT Sbjct: 250 LLELEAAVCLCTTIRLKLLNINIYLPLALSVLLTCGKT 287 >KZV37036.1 36.4 kDa proline-rich protein [Dorcoceras hygrometricum] Length = 265 Score = 71.6 bits (174), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAAVCLCTTIRLKLLNLNIF+PLAL VLATCG T Sbjct: 217 LLELEAAVCLCTTIRLKLLNLNIFLPLALQVLATCGLT 254 >KDO61487.1 hypothetical protein CISIN_1g026333mg [Citrus sinensis] Length = 240 Score = 71.2 bits (173), Expect = 1e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIFIPLAL L TCGKT Sbjct: 193 LLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGKT 230 >XP_006477233.1 PREDICTED: 36.4 kDa proline-rich protein [Citrus sinensis] Length = 240 Score = 71.2 bits (173), Expect = 1e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIFIPLAL L TCGKT Sbjct: 193 LLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGKT 230 >XP_017231866.1 PREDICTED: repetitive proline-rich cell wall protein 2-like [Daucus carota subsp. sativus] Length = 305 Score = 72.0 bits (175), Expect = 1e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAAVCLCTTIRLKLLN+NI++PLALSVL TCGKT Sbjct: 257 LLELEAAVCLCTTIRLKLLNINIYLPLALSVLLTCGKT 294 >XP_006440348.1 hypothetical protein CICLE_v10021835mg [Citrus clementina] ESR53588.1 hypothetical protein CICLE_v10021835mg [Citrus clementina] Length = 252 Score = 71.2 bits (173), Expect = 1e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIFIPLAL L TCGKT Sbjct: 205 LLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGKT 242 >XP_009333634.1 PREDICTED: 36.4 kDa proline-rich protein-like [Pyrus x bretschneideri] Length = 255 Score = 71.2 bits (173), Expect = 1e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 LLELEAAVCLCTTIRLKLLNLNIFIPLALSVLATCGKT 114 LLELEAA+CLCTTIRLKLLNLNIFIPLAL L TCGKT Sbjct: 208 LLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGKT 245