BLASTX nr result
ID: Angelica27_contig00016036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00016036 (240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017250971.1 PREDICTED: pleiotropic drug resistance protein 3-... 70 1e-13 KZM95005.1 hypothetical protein DCAR_018247 [Daucus carota subsp... 70 1e-13 KZM95006.1 hypothetical protein DCAR_018248 [Daucus carota subsp... 70 1e-13 XP_017250326.1 PREDICTED: ABC transporter G family member 42-lik... 70 1e-13 XP_010099712.1 hypothetical protein L484_025145 [Morus notabilis... 65 4e-12 XP_015945033.1 PREDICTED: pleiotropic drug resistance protein 3-... 68 1e-11 XP_016194215.1 PREDICTED: pleiotropic drug resistance protein 3-... 68 1e-11 XP_003609865.2 drug resistance transporter-like ABC domain prote... 66 9e-11 XP_004508092.1 PREDICTED: pleiotropic drug resistance protein 3-... 66 9e-11 XP_004508091.1 PREDICTED: pleiotropic drug resistance protein 3-... 66 9e-11 KHN03242.1 Pleiotropic drug resistance protein 3 [Glycine soja] 65 1e-10 KRH02440.1 hypothetical protein GLYMA_17G039200 [Glycine max] KR... 65 1e-10 XP_004298258.1 PREDICTED: pleiotropic drug resistance protein 3-... 65 1e-10 XP_010099709.1 Pleiotropic drug resistance protein 3 [Morus nota... 65 1e-10 XP_003550575.1 PREDICTED: pleiotropic drug resistance protein 3-... 65 1e-10 XP_006600401.1 PREDICTED: pleiotropic drug resistance protein 3-... 65 1e-10 XP_006387957.1 hypothetical protein POPTR_0455s002102g, partial ... 65 2e-10 XP_003528598.1 PREDICTED: pleiotropic drug resistance protein 3-... 65 2e-10 XP_006583982.1 PREDICTED: pleiotropic drug resistance protein 3-... 65 2e-10 XP_019431150.1 PREDICTED: pleiotropic drug resistance protein 3-... 65 2e-10 >XP_017250971.1 PREDICTED: pleiotropic drug resistance protein 3-like [Daucus carota subsp. sativus] Length = 1417 Score = 69.7 bits (169), Expect(2) = 1e-13 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 ++PKW VWCY I P+SWSLRS ITTQYGD+DKEI VL KK+ Sbjct: 1330 QMPKWWVWCYWILPTSWSLRSFITTQYGDVDKEIGVLGEKKA 1371 Score = 33.5 bits (75), Expect(2) = 1e-13 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 67 GERKAINAFLERNFGYRNDDT 5 GE+KA NAFLE +GYR+ DT Sbjct: 1367 GEKKATNAFLESYYGYRSGDT 1387 >KZM95005.1 hypothetical protein DCAR_018247 [Daucus carota subsp. sativus] Length = 811 Score = 69.7 bits (169), Expect(2) = 1e-13 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 ++PKW VWCY I P+SWSLRS ITTQYGD+DKEI VL KK+ Sbjct: 724 QMPKWWVWCYWILPTSWSLRSFITTQYGDVDKEIGVLGEKKA 765 Score = 33.5 bits (75), Expect(2) = 1e-13 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 67 GERKAINAFLERNFGYRNDDT 5 GE+KA NAFLE +GYR+ DT Sbjct: 761 GEKKATNAFLESYYGYRSGDT 781 >KZM95006.1 hypothetical protein DCAR_018248 [Daucus carota subsp. sativus] Length = 805 Score = 69.7 bits (169), Expect(2) = 1e-13 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 ++PKW VWCY I P+SWSLRS ITTQYGD+DKEI VL KK+ Sbjct: 718 QMPKWWVWCYWILPTSWSLRSFITTQYGDVDKEIGVLGEKKA 759 Score = 33.5 bits (75), Expect(2) = 1e-13 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 67 GERKAINAFLERNFGYRNDDT 5 GE+KA NAFLE +GYR+ DT Sbjct: 755 GEKKATNAFLESYYGYRSGDT 775 >XP_017250326.1 PREDICTED: ABC transporter G family member 42-like [Daucus carota subsp. sativus] Length = 468 Score = 69.7 bits (169), Expect(2) = 1e-13 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 ++PKW VWCY I P+SWSLRS ITTQYGD+DKEI VL KK+ Sbjct: 381 QMPKWWVWCYWILPTSWSLRSFITTQYGDVDKEIGVLGEKKA 422 Score = 33.5 bits (75), Expect(2) = 1e-13 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 67 GERKAINAFLERNFGYRNDDT 5 GE+KA NAFLE +GYR+ DT Sbjct: 418 GEKKATNAFLESYYGYRSGDT 438 >XP_010099712.1 hypothetical protein L484_025145 [Morus notabilis] EXB80289.1 hypothetical protein L484_025145 [Morus notabilis] Length = 100 Score = 65.5 bits (158), Expect = 4e-12 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 +IPKW VWCY ICP+SWSL L+T+QYGD+DKEI + KS Sbjct: 13 KIPKWWVWCYWICPTSWSLNGLLTSQYGDMDKEIMIFGELKS 54 >XP_015945033.1 PREDICTED: pleiotropic drug resistance protein 3-like [Arachis duranensis] Length = 1416 Score = 68.2 bits (165), Expect = 1e-11 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKSHKCIFRKKFW 24 +IPKW VWCY ICP++WSL L+T+QYGD+DKEI + +GKK F K ++ Sbjct: 1329 KIPKWWVWCYWICPTAWSLNGLLTSQYGDMDKEITI-FGKKEQVGAFLKDYY 1379 >XP_016194215.1 PREDICTED: pleiotropic drug resistance protein 3-like [Arachis ipaensis] Length = 1447 Score = 68.2 bits (165), Expect = 1e-11 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKSHKCIFRKKFW 24 +IPKW VWCY ICP++WSL L+T+QYGD+DKEI + +GKK F K ++ Sbjct: 1360 KIPKWWVWCYWICPTAWSLNGLLTSQYGDMDKEITI-FGKKEQVGAFLKDYY 1410 >XP_003609865.2 drug resistance transporter-like ABC domain protein [Medicago truncatula] AES92062.2 drug resistance transporter-like ABC domain protein [Medicago truncatula] Length = 1431 Score = 65.9 bits (159), Expect = 9e-11 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKK 57 +IPKW VWCY ICP++WSL L+T+QYGD+DKEI + KK Sbjct: 1344 KIPKWWVWCYWICPTAWSLNGLLTSQYGDMDKEILIFGDKK 1384 >XP_004508092.1 PREDICTED: pleiotropic drug resistance protein 3-like isoform X2 [Cicer arietinum] Length = 1433 Score = 65.9 bits (159), Expect = 9e-11 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKK 57 +IPKW VWCY ICP++WSL L+T+QYGD+DKEI + KK Sbjct: 1346 KIPKWWVWCYWICPTAWSLNGLLTSQYGDMDKEILIFGDKK 1386 >XP_004508091.1 PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 [Cicer arietinum] Length = 1434 Score = 65.9 bits (159), Expect = 9e-11 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKK 57 +IPKW VWCY ICP++WSL L+T+QYGD+DKEI + KK Sbjct: 1347 KIPKWWVWCYWICPTAWSLNGLLTSQYGDMDKEILIFGDKK 1387 >KHN03242.1 Pleiotropic drug resistance protein 3 [Glycine soja] Length = 1328 Score = 65.5 bits (158), Expect = 1e-10 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 +IPKW VWCY ICP++WSL L+T+QYGDI+KE+ V +KS Sbjct: 1241 KIPKWWVWCYWICPTAWSLNGLLTSQYGDIEKEVLVFGERKS 1282 >KRH02440.1 hypothetical protein GLYMA_17G039200 [Glycine max] KRH02441.1 hypothetical protein GLYMA_17G039200 [Glycine max] KRH02442.1 hypothetical protein GLYMA_17G039200 [Glycine max] KRH02443.1 hypothetical protein GLYMA_17G039200 [Glycine max] KRH02444.1 hypothetical protein GLYMA_17G039200 [Glycine max] KRH02445.1 hypothetical protein GLYMA_17G039200 [Glycine max] KRH02446.1 hypothetical protein GLYMA_17G039200 [Glycine max] Length = 1388 Score = 65.5 bits (158), Expect = 1e-10 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 +IPKW VWCY ICP++WSL L+T+QYGDI+KE+ V +KS Sbjct: 1301 KIPKWWVWCYWICPTAWSLNGLLTSQYGDIEKEVLVFGERKS 1342 >XP_004298258.1 PREDICTED: pleiotropic drug resistance protein 3-like [Fragaria vesca subsp. vesca] Length = 1430 Score = 65.5 bits (158), Expect = 1e-10 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKSHKCIFRKKFW 24 +IPKW VWCY ICP+SWSL L+T+QYGD+DKEI +++G+ F K ++ Sbjct: 1343 KIPKWWVWCYWICPTSWSLNGLLTSQYGDMDKEI-LIFGEHKTVASFLKDYY 1393 >XP_010099709.1 Pleiotropic drug resistance protein 3 [Morus notabilis] EXB80286.1 Pleiotropic drug resistance protein 3 [Morus notabilis] Length = 1431 Score = 65.5 bits (158), Expect = 1e-10 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 +IPKW VWCY ICP+SWSL L+T+QYGD+DKEI + KS Sbjct: 1344 KIPKWWVWCYWICPTSWSLNGLLTSQYGDMDKEIMIFGELKS 1385 >XP_003550575.1 PREDICTED: pleiotropic drug resistance protein 3-like isoform X2 [Glycine max] KRH02447.1 hypothetical protein GLYMA_17G039200 [Glycine max] Length = 1435 Score = 65.5 bits (158), Expect = 1e-10 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 +IPKW VWCY ICP++WSL L+T+QYGDI+KE+ V +KS Sbjct: 1348 KIPKWWVWCYWICPTAWSLNGLLTSQYGDIEKEVLVFGERKS 1389 >XP_006600401.1 PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 [Glycine max] Length = 1467 Score = 65.5 bits (158), Expect = 1e-10 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 +IPKW VWCY ICP++WSL L+T+QYGDI+KE+ V +KS Sbjct: 1380 KIPKWWVWCYWICPTAWSLNGLLTSQYGDIEKEVLVFGERKS 1421 >XP_006387957.1 hypothetical protein POPTR_0455s002102g, partial [Populus trichocarpa] ERP46871.1 hypothetical protein POPTR_0455s002102g, partial [Populus trichocarpa] Length = 432 Score = 65.1 bits (157), Expect = 2e-10 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -2 Query: 188 YFLEIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAV 72 Y +IPKW +WCY +CP+SWSL +T+QYGDIDKEI++ Sbjct: 342 YVQKIPKWWIWCYYLCPTSWSLNGFLTSQYGDIDKEISI 380 >XP_003528598.1 PREDICTED: pleiotropic drug resistance protein 3-like isoform X2 [Glycine max] KRH50641.1 hypothetical protein GLYMA_07G233900 [Glycine max] Length = 1437 Score = 65.1 bits (157), Expect = 2e-10 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 +IPKW +WCY ICP++WSL L+T+QYGDI+KE+ V +KS Sbjct: 1350 KIPKWWIWCYWICPTAWSLNGLLTSQYGDIEKEVLVFGERKS 1391 >XP_006583982.1 PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 [Glycine max] KHN28177.1 Pleiotropic drug resistance protein 3 [Glycine soja] Length = 1469 Score = 65.1 bits (157), Expect = 2e-10 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKS 54 +IPKW +WCY ICP++WSL L+T+QYGDI+KE+ V +KS Sbjct: 1382 KIPKWWIWCYWICPTAWSLNGLLTSQYGDIEKEVLVFGERKS 1423 >XP_019431150.1 PREDICTED: pleiotropic drug resistance protein 3-like [Lupinus angustifolius] Length = 625 Score = 64.7 bits (156), Expect = 2e-10 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = -2 Query: 179 EIPKWSVWCY*ICPSSWSLRSLITTQYGDIDKEIAVLWGKKSHKCIFRKKFW 24 +IPKW VWCY I P++WSL L+T+QYGD+DKEI +++G+K IF K ++ Sbjct: 538 KIPKWWVWCYWITPTAWSLNGLLTSQYGDMDKEI-LIFGEKKEVGIFLKDYY 588