BLASTX nr result
ID: Angelica27_contig00015952
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00015952 (206 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017229705.1 PREDICTED: flowering time control protein FCA-lik... 94 2e-21 GAU11311.1 hypothetical protein TSUD_343020, partial [Trifolium ... 57 7e-08 >XP_017229705.1 PREDICTED: flowering time control protein FCA-like [Daucus carota subsp. sativus] KZN10228.1 hypothetical protein DCAR_002884 [Daucus carota subsp. sativus] Length = 376 Score = 94.4 bits (233), Expect = 2e-21 Identities = 42/47 (89%), Positives = 42/47 (89%) Frame = -2 Query: 205 TCESRWEKPEEYSFYEQQLQKGLEQGNPQRKQPYMSCSQSHSTDQGF 65 TCESRWEKPEEY FYEQQLQKGLEQGN QRKQPYM CSQ H TDQGF Sbjct: 325 TCESRWEKPEEYLFYEQQLQKGLEQGNSQRKQPYMPCSQIHPTDQGF 371 >GAU11311.1 hypothetical protein TSUD_343020, partial [Trifolium subterraneum] Length = 549 Score = 57.0 bits (136), Expect = 7e-08 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = -2 Query: 205 TCESRWEKPEEYSFYEQQLQKGLEQGNPQRKQPYMSCSQSHSTDQ 71 TCESRWEKPEEY+FY+++ QK EQ +P QP +S S S Q Sbjct: 485 TCESRWEKPEEYAFYDKESQKQHEQDDPSFLQPQLSLSSSQEVSQ 529