BLASTX nr result
ID: Angelica27_contig00015744
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00015744 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN10701.1 hypothetical protein DCAR_003357 [Daucus carota subsp... 63 7e-11 >KZN10701.1 hypothetical protein DCAR_003357 [Daucus carota subsp. sativus] Length = 59 Score = 63.2 bits (152), Expect = 7e-11 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 135 MVDGKVGKYVFYGSAVLLGLVCREVIDKYDKYKAKQ 242 MV+GKVG YV YGSAVLLGL+CRE IDKY+K+KA Q Sbjct: 1 MVEGKVGTYVLYGSAVLLGLICREAIDKYEKHKANQ 36