BLASTX nr result
ID: Angelica27_contig00015541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00015541 (399 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017232889.1 PREDICTED: kxDL motif-containing protein 1 [Daucu... 69 3e-12 XP_006395304.1 hypothetical protein EUTSA_v10005148mg [Eutrema s... 62 1e-09 XP_004150678.1 PREDICTED: kxDL motif-containing protein 1 [Cucum... 62 1e-09 OAY31566.1 hypothetical protein MANES_14G122800 [Manihot esculenta] 62 1e-09 XP_019168744.1 PREDICTED: kxDL motif-containing protein 1 [Ipomo... 61 2e-09 KDO75275.1 hypothetical protein CISIN_1g033257mg [Citrus sinensis] 61 2e-09 NP_001326300.1 kxDL motif protein [Arabidopsis thaliana] NP_0013... 60 2e-09 XP_015382550.1 PREDICTED: kxDL motif-containing protein 1 [Citru... 61 2e-09 CDP17315.1 unnamed protein product [Coffea canephora] 61 2e-09 KDO75273.1 hypothetical protein CISIN_1g033257mg [Citrus sinensis] 61 2e-09 XP_006448916.1 hypothetical protein CICLE_v10017190mg [Citrus cl... 61 2e-09 XP_019099913.1 PREDICTED: kxDL motif-containing protein 1-like [... 60 2e-09 OAY79158.1 hypothetical protein ACMD2_19116 [Ananas comosus] 59 3e-09 XP_008460924.1 PREDICTED: kxDL motif-containing protein 1 [Cucum... 60 4e-09 NP_189557.2 kxDL motif protein [Arabidopsis thaliana] NP_0013262... 60 4e-09 XP_010425715.1 PREDICTED: kxDL motif-containing protein 1-like [... 60 4e-09 XP_010514629.1 PREDICTED: kxDL motif-containing protein 1 [Camel... 60 4e-09 XP_002877157.1 hypothetical protein ARALYDRAFT_905203 [Arabidops... 60 4e-09 OAP05830.1 hypothetical protein AXX17_AT3G31920 [Arabidopsis tha... 59 5e-09 OAP05831.1 hypothetical protein AXX17_AT3G31920 [Arabidopsis tha... 59 9e-09 >XP_017232889.1 PREDICTED: kxDL motif-containing protein 1 [Daucus carota subsp. sativus] Length = 126 Score = 68.6 bits (166), Expect = 3e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RSMK KI+ATYPDAFPDDSATRALDRRPDLE+PQ Sbjct: 93 RSMKAKIVATYPDAFPDDSATRALDRRPDLEMPQ 126 >XP_006395304.1 hypothetical protein EUTSA_v10005148mg [Eutrema salsugineum] ESQ32590.1 hypothetical protein EUTSA_v10005148mg [Eutrema salsugineum] Length = 119 Score = 61.6 bits (148), Expect = 1e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RS+KTKI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 86 RSIKTKILATYPDAFPDDSTSDAFDRRPDLELPQ 119 >XP_004150678.1 PREDICTED: kxDL motif-containing protein 1 [Cucumis sativus] KGN62123.1 hypothetical protein Csa_2G299930 [Cucumis sativus] Length = 124 Score = 61.6 bits (148), Expect = 1e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RSMK+KI+ATYPDAFPD+S + ALDRRPDLEIP+ Sbjct: 91 RSMKSKILATYPDAFPDESTSEALDRRPDLEIPR 124 >OAY31566.1 hypothetical protein MANES_14G122800 [Manihot esculenta] Length = 125 Score = 61.6 bits (148), Expect = 1e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ*Q 292 RSMKTKI+ATYPDAFPD+S LDRRPDLE+PQ Q Sbjct: 90 RSMKTKILATYPDAFPDESTQEVLDRRPDLEMPQTQ 125 >XP_019168744.1 PREDICTED: kxDL motif-containing protein 1 [Ipomoea nil] Length = 123 Score = 61.2 bits (147), Expect = 2e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RSMK KI+ATYPDAFPDDS +ALD RPDLE+PQ Sbjct: 90 RSMKAKILATYPDAFPDDSTAQALDSRPDLELPQ 123 >KDO75275.1 hypothetical protein CISIN_1g033257mg [Citrus sinensis] Length = 110 Score = 60.8 bits (146), Expect = 2e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RSMK KI+ATYPDAFPD+S ALDRRPDLE+PQ Sbjct: 77 RSMKAKILATYPDAFPDESTIEALDRRPDLEMPQ 110 >NP_001326300.1 kxDL motif protein [Arabidopsis thaliana] NP_001326297.1 kxDL motif protein [Arabidopsis thaliana] ANM64257.1 kxDL motif protein [Arabidopsis thaliana] ANM64260.1 kxDL motif protein [Arabidopsis thaliana] Length = 91 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RS+K+KI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 58 RSIKSKILATYPDAFPDDSTSDAFDRRPDLELPQ 91 >XP_015382550.1 PREDICTED: kxDL motif-containing protein 1 [Citrus sinensis] Length = 123 Score = 60.8 bits (146), Expect = 2e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RSMK KI+ATYPDAFPD+S ALDRRPDLE+PQ Sbjct: 90 RSMKAKILATYPDAFPDESTIEALDRRPDLEMPQ 123 >CDP17315.1 unnamed protein product [Coffea canephora] Length = 123 Score = 60.8 bits (146), Expect = 2e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RSMK KI+ATYPDAFPDDS LDRRPDLE+PQ Sbjct: 90 RSMKAKILATYPDAFPDDSTIEELDRRPDLELPQ 123 >KDO75273.1 hypothetical protein CISIN_1g033257mg [Citrus sinensis] Length = 123 Score = 60.8 bits (146), Expect = 2e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RSMK KI+ATYPDAFPD+S ALDRRPDLE+PQ Sbjct: 90 RSMKAKILATYPDAFPDESTIEALDRRPDLEMPQ 123 >XP_006448916.1 hypothetical protein CICLE_v10017190mg [Citrus clementina] ESR62156.1 hypothetical protein CICLE_v10017190mg [Citrus clementina] Length = 123 Score = 60.8 bits (146), Expect = 2e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RSMK KI+ATYPDAFPD+S ALDRRPDLE+PQ Sbjct: 90 RSMKAKILATYPDAFPDESTIEALDRRPDLEMPQ 123 >XP_019099913.1 PREDICTED: kxDL motif-containing protein 1-like [Camelina sativa] Length = 94 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RS+K+KI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 61 RSIKSKILATYPDAFPDDSTSDAFDRRPDLELPQ 94 >OAY79158.1 hypothetical protein ACMD2_19116 [Ananas comosus] Length = 46 Score = 58.5 bits (140), Expect = 3e-09 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIP 301 RSMK K++ATYPDAFPD S+T+ LD+RPDLEIP Sbjct: 13 RSMKAKLVATYPDAFPDGSSTKMLDQRPDLEIP 45 >XP_008460924.1 PREDICTED: kxDL motif-containing protein 1 [Cucumis melo] XP_008460925.1 PREDICTED: kxDL motif-containing protein 1 [Cucumis melo] Length = 124 Score = 60.5 bits (145), Expect = 4e-09 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RSMK++I+ATYPDAFPD+S + ALDRRPDLEIP+ Sbjct: 91 RSMKSRILATYPDAFPDESTSEALDRRPDLEIPR 124 >NP_189557.2 kxDL motif protein [Arabidopsis thaliana] NP_001326299.1 kxDL motif protein [Arabidopsis thaliana] NP_001326298.1 kxDL motif protein [Arabidopsis thaliana] BAB01990.1 unnamed protein product [Arabidopsis thaliana] AEE77538.1 kxDL motif protein [Arabidopsis thaliana] ANM64258.1 kxDL motif protein [Arabidopsis thaliana] ANM64259.1 kxDL motif protein [Arabidopsis thaliana] Length = 119 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RS+K+KI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 86 RSIKSKILATYPDAFPDDSTSDAFDRRPDLELPQ 119 >XP_010425715.1 PREDICTED: kxDL motif-containing protein 1-like [Camelina sativa] XP_010425716.1 PREDICTED: kxDL motif-containing protein 1-like [Camelina sativa] Length = 119 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RS+K+KI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 86 RSIKSKILATYPDAFPDDSTSDAFDRRPDLELPQ 119 >XP_010514629.1 PREDICTED: kxDL motif-containing protein 1 [Camelina sativa] Length = 119 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RS+K+KI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 86 RSIKSKILATYPDAFPDDSTSDAFDRRPDLELPQ 119 >XP_002877157.1 hypothetical protein ARALYDRAFT_905203 [Arabidopsis lyrata subsp. lyrata] EFH53416.1 hypothetical protein ARALYDRAFT_905203 [Arabidopsis lyrata subsp. lyrata] Length = 119 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RS+K+KI+ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 86 RSIKSKILATYPDAFPDDSTSDAFDRRPDLELPQ 119 >OAP05830.1 hypothetical protein AXX17_AT3G31920 [Arabidopsis thaliana] Length = 91 Score = 59.3 bits (142), Expect = 5e-09 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RS+K+K++ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 58 RSIKSKLLATYPDAFPDDSTSDAFDRRPDLELPQ 91 >OAP05831.1 hypothetical protein AXX17_AT3G31920 [Arabidopsis thaliana] Length = 119 Score = 59.3 bits (142), Expect = 9e-09 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 399 RSMKTKIIATYPDAFPDDSATRALDRRPDLEIPQ 298 RS+K+K++ATYPDAFPDDS + A DRRPDLE+PQ Sbjct: 86 RSIKSKLLATYPDAFPDDSTSDAFDRRPDLELPQ 119