BLASTX nr result
ID: Angelica27_contig00015345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00015345 (218 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN07199.1 hypothetical protein DCAR_008036 [Daucus carota subsp... 64 8e-12 >KZN07199.1 hypothetical protein DCAR_008036 [Daucus carota subsp. sativus] Length = 85 Score = 63.9 bits (154), Expect = 8e-12 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 101 KHSDTDLPYSTSTPLPFYSCGATTSAGLPCFTQNRPAKL 217 KHS TDL S+S LPFYSCGAT SAG+PCFT+NR AKL Sbjct: 13 KHSHTDLTCSSSPALPFYSCGATNSAGVPCFTENRAAKL 51