BLASTX nr result
ID: Angelica27_contig00015338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00015338 (726 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017231260.1 PREDICTED: uncharacterized protein LOC108205731 [... 96 4e-19 >XP_017231260.1 PREDICTED: uncharacterized protein LOC108205731 [Daucus carota subsp. sativus] KZN04984.1 hypothetical protein DCAR_005821 [Daucus carota subsp. sativus] Length = 435 Score = 95.5 bits (236), Expect = 4e-19 Identities = 46/65 (70%), Positives = 53/65 (81%) Frame = -2 Query: 614 DY*PLFCGPESTKELIRPGFLAINLQGPHQIERPLNYIRGLLDSTKLVTIDPTIRRRVLT 435 DY PLF PES ++L+RPGFLA+N QGP QI+RPLNY+RG LDS KLVTID IRRR L Sbjct: 30 DYQPLFLSPESPQDLVRPGFLAMNPQGPLQIDRPLNYMRGFLDSNKLVTIDSAIRRRELI 89 Query: 434 DVQGS 420 DVQG+ Sbjct: 90 DVQGN 94