BLASTX nr result
ID: Angelica27_contig00015333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00015333 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_001152053.1 ORF47a [Pinus koraiensis] AAO73984.2 ORF47a (chlo... 57 2e-08 CCA94636.1 maturase K, partial (plastid) [Clematis vitalba] 60 2e-08 >YP_001152053.1 ORF47a [Pinus koraiensis] AAO73984.2 ORF47a (chloroplast) [Pinus koraiensis] Length = 47 Score = 57.0 bits (136), Expect = 2e-08 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 3/43 (6%) Frame = +2 Query: 134 IGKAVCNEKCKHGLGRG---VYLFNREIIYSIRLVPGSNPGQP 253 +GKAVCNE CKHGLGR + + +II+SIR PGS+PGQP Sbjct: 1 MGKAVCNENCKHGLGRDFSLLLILKEQIIHSIRRAPGSSPGQP 43 >CCA94636.1 maturase K, partial (plastid) [Clematis vitalba] Length = 188 Score = 60.1 bits (144), Expect = 2e-08 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +2 Query: 62 VRVKSTEYSTFLKF*VRNRVLNVYIGKAVCNEKCKHGLGR 181 V ++STEYSTFL++ + N + N+YI KAVCNEKC+HGLGR Sbjct: 149 VVIESTEYSTFLEYRLGNCIFNLYIEKAVCNEKCRHGLGR 188