BLASTX nr result
ID: Angelica27_contig00015202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00015202 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017221192.1 PREDICTED: uncharacterized WD repeat-containing p... 55 2e-06 XP_010695887.1 PREDICTED: uncharacterized protein LOC104908468 [... 54 4e-06 KZM83513.1 hypothetical protein DCAR_031082 [Daucus carota subsp... 53 5e-06 XP_017223858.1 PREDICTED: LOW QUALITY PROTEIN: myosin heavy chai... 53 6e-06 >XP_017221192.1 PREDICTED: uncharacterized WD repeat-containing protein alr2800-like [Daucus carota subsp. sativus] KZM86017.1 hypothetical protein DCAR_026561 [Daucus carota subsp. sativus] Length = 405 Score = 54.7 bits (130), Expect = 2e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 Query: 263 TSGDGISYLVYSGSLDCDVKVWQIWVPF 180 +S G+ YLVYSGSLDCDVKVWQIWVPF Sbjct: 377 SSAIGMPYLVYSGSLDCDVKVWQIWVPF 404 >XP_010695887.1 PREDICTED: uncharacterized protein LOC104908468 [Beta vulgaris subsp. vulgaris] KMS97364.1 hypothetical protein BVRB_6g156050 [Beta vulgaris subsp. vulgaris] Length = 408 Score = 53.5 bits (127), Expect = 4e-06 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = -2 Query: 293 CDRSIIVWEKTSGDGISYLVYSGSLDCDVKVWQIWVP 183 C + + TS G SYL+YSGSLDCD+KVW+IWVP Sbjct: 370 CIAAAVDSNNTSNYGTSYLIYSGSLDCDIKVWKIWVP 406 >KZM83513.1 hypothetical protein DCAR_031082 [Daucus carota subsp. sativus] Length = 342 Score = 53.1 bits (126), Expect = 5e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -2 Query: 251 GISYLVYSGSLDCDVKVWQIWVPFL 177 G YL+YSGSLDCDVKVWQIWVPF+ Sbjct: 318 GTPYLIYSGSLDCDVKVWQIWVPFV 342 >XP_017223858.1 PREDICTED: LOW QUALITY PROTEIN: myosin heavy chain kinase A-like [Daucus carota subsp. sativus] Length = 406 Score = 53.1 bits (126), Expect = 6e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -2 Query: 251 GISYLVYSGSLDCDVKVWQIWVPFL 177 G YL+YSGSLDCDVKVWQIWVPF+ Sbjct: 382 GTPYLIYSGSLDCDVKVWQIWVPFV 406