BLASTX nr result
ID: Angelica27_contig00015063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00015063 (620 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017232684.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4-li... 127 6e-34 XP_017242597.1 PREDICTED: zinc finger protein CONSTANS-LIKE 9-li... 126 2e-33 XP_006383971.1 hypothetical protein POPTR_0004s02600g [Populus t... 110 3e-27 XP_016505956.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-li... 107 5e-26 XP_018856941.1 PREDICTED: B-box domain protein 31-like, partial ... 105 6e-26 XP_006467930.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4 is... 107 7e-26 XP_019162275.1 PREDICTED: zinc finger protein CONSTANS-LIKE 9-li... 108 7e-26 XP_015382329.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4 is... 107 7e-26 XP_018855619.1 PREDICTED: zinc finger protein HD1-like [Juglans ... 107 9e-26 XP_006467929.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4 is... 107 9e-26 XP_006467928.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4 is... 107 9e-26 XP_006449179.1 hypothetical protein CICLE_v10016798mg [Citrus cl... 107 1e-25 XP_006449180.1 hypothetical protein CICLE_v10016798mg [Citrus cl... 107 1e-25 XP_018831379.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4-li... 105 2e-25 XP_018634259.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-li... 105 3e-25 XP_009629256.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-li... 105 3e-25 XP_019246106.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-li... 105 4e-25 XP_019246105.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-li... 105 4e-25 XP_019246104.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-li... 105 5e-25 XP_009768391.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-li... 105 8e-25 >XP_017232684.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Daucus carota subsp. sativus] Length = 162 Score = 127 bits (320), Expect = 6e-34 Identities = 59/68 (86%), Positives = 61/68 (89%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW+CDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTL VHG Sbjct: 18 SDQASLCWSCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTL------XVHG 71 Query: 182 DSSHNNHV 205 DSSHNNH+ Sbjct: 72 DSSHNNHI 79 >XP_017242597.1 PREDICTED: zinc finger protein CONSTANS-LIKE 9-like [Daucus carota subsp. sativus] Length = 155 Score = 126 bits (316), Expect = 2e-33 Identities = 69/142 (48%), Positives = 80/142 (56%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CDAKVHSANFLVAKHSRTLLCQ+CQ+LTPWTGSGPKLG TLS CES CVH Sbjct: 17 SDQASLCWQCDAKVHSANFLVAKHSRTLLCQSCQALTPWTGSGPKLGPTLSFCES-CVHE 75 Query: 182 DSSHNNHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 361 ++++NN Sbjct: 76 NTNYNNDT--DEDDEDEEDDEDDEEDEEEDDGENQVVPLSSSSLAPPQVTSSSSSEESSA 133 Query: 362 RLFNGAQSNRQPRFSIPWTRNQ 427 RLFNGA+S+R+ RFSI W+R + Sbjct: 134 RLFNGAESSRKSRFSISWSRTR 155 >XP_006383971.1 hypothetical protein POPTR_0004s02600g [Populus trichocarpa] ERP61768.1 hypothetical protein POPTR_0004s02600g [Populus trichocarpa] Length = 151 Score = 110 bits (274), Expect = 3e-27 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESC 169 SDQASLCW CDA VHSANFLVAKHSRTLLC CQSLTPWTG+GPKLG TLSVC++C Sbjct: 17 SDQASLCWDCDANVHSANFLVAKHSRTLLCHVCQSLTPWTGTGPKLGPTLSVCDNC 72 >XP_016505956.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Nicotiana tabacum] Length = 176 Score = 107 bits (268), Expect = 5e-26 Identities = 48/67 (71%), Positives = 56/67 (83%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CDA+VH+ANFLVAKHSR LLC +CQSLTPWTGSG KLG T+SVC++ C H Sbjct: 17 SDQASLCWDCDARVHAANFLVAKHSRNLLCNSCQSLTPWTGSGSKLGPTVSVCQT-CFHR 75 Query: 182 DSSHNNH 202 ++ NH Sbjct: 76 NNDRANH 82 >XP_018856941.1 PREDICTED: B-box domain protein 31-like, partial [Juglans regia] Length = 120 Score = 105 bits (263), Expect = 6e-26 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESC 169 SDQASLCW CDAKVH ANFLVA+HSRTLLC +CQS TPW SG KLGHT+SVCESC Sbjct: 17 SDQASLCWNCDAKVHGANFLVARHSRTLLCHSCQSHTPWKASGSKLGHTVSVCESC 72 >XP_006467930.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4 isoform X3 [Citrus sinensis] KDO75670.1 hypothetical protein CISIN_1g029117mg [Citrus sinensis] Length = 185 Score = 107 bits (268), Expect = 7e-26 Identities = 48/63 (76%), Positives = 50/63 (79%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CDAKVH ANFLVA HSRTLLC CQSLTPW GSGPKLG T+SVC C +G Sbjct: 17 SDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGNG 76 Query: 182 DSS 190 S Sbjct: 77 SGS 79 >XP_019162275.1 PREDICTED: zinc finger protein CONSTANS-LIKE 9-like [Ipomoea nil] Length = 199 Score = 108 bits (269), Expect = 7e-26 Identities = 46/56 (82%), Positives = 52/56 (92%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESC 169 SDQA+LCW CDA+VHSANFLVAKH+RTLLCQ CQS TPWTGSGPKLG T+SVC++C Sbjct: 17 SDQANLCWECDARVHSANFLVAKHTRTLLCQACQSQTPWTGSGPKLGPTVSVCQAC 72 >XP_015382329.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4 isoform X2 [Citrus sinensis] Length = 186 Score = 107 bits (268), Expect = 7e-26 Identities = 48/63 (76%), Positives = 50/63 (79%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CDAKVH ANFLVA HSRTLLC CQSLTPW GSGPKLG T+SVC C +G Sbjct: 17 SDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGNG 76 Query: 182 DSS 190 S Sbjct: 77 SGS 79 >XP_018855619.1 PREDICTED: zinc finger protein HD1-like [Juglans regia] XP_018811678.1 PREDICTED: zinc finger protein HD1-like [Juglans regia] XP_018811679.1 PREDICTED: zinc finger protein HD1-like [Juglans regia] Length = 170 Score = 107 bits (266), Expect = 9e-26 Identities = 46/56 (82%), Positives = 48/56 (85%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESC 169 SDQASLCW CDA+VH ANFLVAKHSRTLLC CQS TPW GSGPKLG T+S CESC Sbjct: 17 SDQASLCWNCDAQVHGANFLVAKHSRTLLCHVCQSFTPWNGSGPKLGPTISACESC 72 >XP_006467929.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4 isoform X1 [Citrus sinensis] KDO75669.1 hypothetical protein CISIN_1g029117mg [Citrus sinensis] Length = 197 Score = 107 bits (268), Expect = 9e-26 Identities = 48/63 (76%), Positives = 50/63 (79%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CDAKVH ANFLVA HSRTLLC CQSLTPW GSGPKLG T+SVC C +G Sbjct: 17 SDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGNG 76 Query: 182 DSS 190 S Sbjct: 77 SGS 79 >XP_006467928.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4 isoform X4 [Citrus sinensis] KDO75668.1 hypothetical protein CISIN_1g029117mg [Citrus sinensis] Length = 198 Score = 107 bits (268), Expect = 9e-26 Identities = 48/63 (76%), Positives = 50/63 (79%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CDAKVH ANFLVA HSRTLLC CQSLTPW GSGPKLG T+SVC C +G Sbjct: 17 SDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGNG 76 Query: 182 DSS 190 S Sbjct: 77 SGS 79 >XP_006449179.1 hypothetical protein CICLE_v10016798mg [Citrus clementina] ESR62419.1 hypothetical protein CICLE_v10016798mg [Citrus clementina] Length = 196 Score = 107 bits (267), Expect = 1e-25 Identities = 48/63 (76%), Positives = 49/63 (77%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CD KVH ANFLVAKHSRTLLC CQSLTPW GSGPKLG T+SVC C G Sbjct: 17 SDQASLCWDCDTKVHGANFLVAKHSRTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGDG 76 Query: 182 DSS 190 S Sbjct: 77 SGS 79 >XP_006449180.1 hypothetical protein CICLE_v10016798mg [Citrus clementina] ESR62420.1 hypothetical protein CICLE_v10016798mg [Citrus clementina] Length = 197 Score = 107 bits (267), Expect = 1e-25 Identities = 48/63 (76%), Positives = 49/63 (77%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CD KVH ANFLVAKHSRTLLC CQSLTPW GSGPKLG T+SVC C G Sbjct: 17 SDQASLCWDCDTKVHGANFLVAKHSRTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGDG 76 Query: 182 DSS 190 S Sbjct: 77 SGS 79 >XP_018831379.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Juglans regia] Length = 150 Score = 105 bits (262), Expect = 2e-25 Identities = 46/56 (82%), Positives = 48/56 (85%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESC 169 SDQASLCW CDA+VH ANFLVAKHSRTLLC CQS TPW GSGPKLG T+SVCE C Sbjct: 17 SDQASLCWDCDARVHGANFLVAKHSRTLLCHVCQSSTPWNGSGPKLGPTISVCEIC 72 >XP_018634259.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-like isoform X2 [Nicotiana tomentosiformis] Length = 177 Score = 105 bits (263), Expect = 3e-25 Identities = 47/67 (70%), Positives = 56/67 (83%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CDA+VH+ANFLVAKHSR LLC +CQSLTPWTGSG KLG T+SVC++ C H Sbjct: 17 SDQASLCWDCDARVHAANFLVAKHSRNLLCNSCQSLTPWTGSGSKLGPTVSVCQT-CFHR 75 Query: 182 DSSHNNH 202 ++ +H Sbjct: 76 NNDRADH 82 >XP_009629256.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-like isoform X1 [Nicotiana tomentosiformis] Length = 183 Score = 105 bits (263), Expect = 3e-25 Identities = 47/67 (70%), Positives = 56/67 (83%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESCCVHG 181 SDQASLCW CDA+VH+ANFLVAKHSR LLC +CQSLTPWTGSG KLG T+SVC++ C H Sbjct: 17 SDQASLCWDCDARVHAANFLVAKHSRNLLCNSCQSLTPWTGSGSKLGPTVSVCQT-CFHR 75 Query: 182 DSSHNNH 202 ++ +H Sbjct: 76 NNDRADH 82 >XP_019246106.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-like isoform X3 [Nicotiana attenuata] Length = 175 Score = 105 bits (262), Expect = 4e-25 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESC 169 SDQASLCW CDA+VH+ANFLVAKHSR LLC +CQSLTPWTGSG KLG T+SVC++C Sbjct: 17 SDQASLCWDCDARVHAANFLVAKHSRNLLCNSCQSLTPWTGSGSKLGSTVSVCQTC 72 >XP_019246105.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-like isoform X2 [Nicotiana attenuata] Length = 178 Score = 105 bits (262), Expect = 4e-25 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESC 169 SDQASLCW CDA+VH+ANFLVAKHSR LLC +CQSLTPWTGSG KLG T+SVC++C Sbjct: 17 SDQASLCWDCDARVHAANFLVAKHSRNLLCNSCQSLTPWTGSGSKLGSTVSVCQTC 72 >XP_019246104.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-like isoform X1 [Nicotiana attenuata] OIT03758.1 b-box domain protein 31 [Nicotiana attenuata] Length = 184 Score = 105 bits (262), Expect = 5e-25 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESC 169 SDQASLCW CDA+VH+ANFLVAKHSR LLC +CQSLTPWTGSG KLG T+SVC++C Sbjct: 17 SDQASLCWDCDARVHAANFLVAKHSRNLLCNSCQSLTPWTGSGSKLGSTVSVCQTC 72 >XP_009768391.1 PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Nicotiana sylvestris] XP_016437678.1 PREDICTED: B-box zinc finger protein 23-like [Nicotiana tabacum] Length = 189 Score = 105 bits (261), Expect = 8e-25 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +2 Query: 2 SDQASLCWTCDAKVHSANFLVAKHSRTLLCQTCQSLTPWTGSGPKLGHTLSVCESC 169 SDQASLCW CDA+VH+ANFLVAKHSR LLC +CQSLTPWTGSG KLG T+SVC++C Sbjct: 17 SDQASLCWDCDARVHAANFLVAKHSRNLLCNSCQSLTPWTGSGSKLGPTVSVCQTC 72