BLASTX nr result
ID: Angelica27_contig00014798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00014798 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM87270.1 hypothetical protein DCAR_024404 [Daucus carota subsp... 85 3e-19 XP_017219103.1 PREDICTED: protein CLT1, chloroplastic [Daucus ca... 85 2e-17 >KZM87270.1 hypothetical protein DCAR_024404 [Daucus carota subsp. sativus] Length = 136 Score = 84.7 bits (208), Expect = 3e-19 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 2/72 (2%) Frame = +3 Query: 18 MSAAYYRRITTGAAHFRQPPIPT--PPIRLAGKILLSPSPPRRISLRLSNRCPWLIEAVP 191 MSAAYYRRIT GAAHFRQP IPT PP+ L+ K LL PS PR+ISLR S+ WLIEA P Sbjct: 1 MSAAYYRRITAGAAHFRQPTIPTPPPPVHLSEK-LLFPS-PRQISLRSSHTRQWLIEAAP 58 Query: 192 VGPTEIQSESDN 227 VGP ++QS + Sbjct: 59 VGPRQLQSSQSS 70 >XP_017219103.1 PREDICTED: protein CLT1, chloroplastic [Daucus carota subsp. sativus] Length = 434 Score = 84.7 bits (208), Expect = 2e-17 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 2/72 (2%) Frame = +3 Query: 18 MSAAYYRRITTGAAHFRQPPIPT--PPIRLAGKILLSPSPPRRISLRLSNRCPWLIEAVP 191 MSAAYYRRIT GAAHFRQP IPT PP+ L+ K LL PS PR+ISLR S+ WLIEA P Sbjct: 1 MSAAYYRRITAGAAHFRQPTIPTPPPPVHLSEK-LLFPS-PRQISLRSSHTRQWLIEAAP 58 Query: 192 VGPTEIQSESDN 227 VGP ++QS + Sbjct: 59 VGPRQLQSSQSS 70