BLASTX nr result
ID: Angelica27_contig00014783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00014783 (574 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN04632.1 hypothetical protein DCAR_005469 [Daucus carota subsp... 64 2e-14 XP_006355775.1 PREDICTED: uncharacterized protein LOC102603203 [... 54 2e-06 KVI08229.1 hypothetical protein Ccrd_013400 [Cynara cardunculus ... 45 9e-06 >KZN04632.1 hypothetical protein DCAR_005469 [Daucus carota subsp. sativus] Length = 66 Score = 63.9 bits (154), Expect(2) = 2e-14 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 66 MLRTRLLWFTLGFGSATAAMGHFVFRDLWLH 158 MLRTRLLWFTLGFG ATAAMG+FVFRDLW H Sbjct: 1 MLRTRLLWFTLGFGCATAAMGNFVFRDLWFH 31 Score = 42.4 bits (98), Expect(2) = 2e-14 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +2 Query: 185 LKQQFEALDSRVSNLEHLLPHPSNSTKE 268 L Q+FEALDSRVS LEHL P SNST+E Sbjct: 39 LNQKFEALDSRVSKLEHLNPQFSNSTQE 66 >XP_006355775.1 PREDICTED: uncharacterized protein LOC102603203 [Solanum tuberosum] Length = 69 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +3 Query: 66 MLRTRLLWFTLGFGSATAAMGHFVFRDLWLH 158 M+R RL+WFTLGF SA+AAM F+FRDLW H Sbjct: 1 MMRIRLVWFTLGFTSASAAMSQFIFRDLWAH 31 >KVI08229.1 hypothetical protein Ccrd_013400 [Cynara cardunculus var. scolymus] Length = 98 Score = 45.4 bits (106), Expect(2) = 9e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +3 Query: 66 MLRTRLLWFTLGFGSATAAMGHFVFRDLWL 155 MLRTRL+WFT GF S A M FV+RDL L Sbjct: 1 MLRTRLVWFTFGFASTAAVMSQFVYRDLLL 30 Score = 31.6 bits (70), Expect(2) = 9e-06 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +2 Query: 185 LKQQFEALDSRVSNLEHLLP 244 LKQQF++L+SR+SNLE LP Sbjct: 39 LKQQFDSLESRLSNLESELP 58