BLASTX nr result
ID: Angelica27_contig00014676
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00014676 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009395723.1 PREDICTED: 60S ribosomal protein L27-like [Musa a... 83 6e-18 ABK22795.1 unknown [Picea sitchensis] ABK25628.1 unknown [Picea ... 81 3e-17 XP_017241762.1 PREDICTED: 60S ribosomal protein L27-like [Daucus... 81 5e-17 XP_011095690.1 PREDICTED: 60S ribosomal protein L27-3-like [Sesa... 81 5e-17 XP_006481358.1 PREDICTED: 60S ribosomal protein L27 [Citrus sine... 81 5e-17 KVI09656.1 KOW-like protein [Cynara cardunculus var. scolymus] 80 6e-17 XP_011000630.1 PREDICTED: 60S ribosomal protein L27-3-like [Popu... 80 6e-17 ADE76927.1 unknown [Picea sitchensis] 80 6e-17 KZV50581.1 hypothetical protein F511_33122 [Dorcoceras hygrometr... 80 9e-17 ABK93484.1 unknown [Populus trichocarpa] 80 9e-17 XP_009609639.1 PREDICTED: 60S ribosomal protein L27 [Nicotiana t... 80 1e-16 XP_002300063.1 60S ribosomal protein L27 [Populus trichocarpa] A... 80 1e-16 OMO95903.1 Ribosomal protein L27e [Corchorus capsularis] OMP0764... 79 2e-16 XP_016751024.1 PREDICTED: 60S ribosomal protein L27-3-like [Goss... 79 2e-16 XP_012849200.1 PREDICTED: 60S ribosomal protein L27-2-like [Eryt... 79 2e-16 XP_012460647.1 PREDICTED: 60S ribosomal protein L27-3-like [Goss... 79 2e-16 XP_012472406.1 PREDICTED: 60S ribosomal protein L27-3-like [Goss... 79 2e-16 XP_009395990.1 PREDICTED: 60S ribosomal protein L27-3 [Musa acum... 79 2e-16 XP_004241408.1 PREDICTED: 60S ribosomal protein L27 [Solanum lyc... 79 2e-16 KZV36253.1 hypothetical protein F511_14271 [Dorcoceras hygrometr... 79 3e-16 >XP_009395723.1 PREDICTED: 60S ribosomal protein L27-like [Musa acuminata subsp. malaccensis] Length = 135 Score = 83.2 bits (204), Expect = 6e-18 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD +++RDKKVTACK KA LEERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVTADSLQSRDKKVTACKETKARLEERFKTGKNRWFFTKLRF 135 >ABK22795.1 unknown [Picea sitchensis] ABK25628.1 unknown [Picea sitchensis] Length = 135 Score = 81.3 bits (199), Expect = 3e-17 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V DK+ETRDKKV A K VKAS EERFK GKNRWFFTKLRF Sbjct: 88 DVDLKNVVSFDKLETRDKKVAALKGVKASFEERFKAGKNRWFFTKLRF 135 >XP_017241762.1 PREDICTED: 60S ribosomal protein L27-like [Daucus carota subsp. sativus] XP_017220034.1 PREDICTED: 60S ribosomal protein L27-like [Daucus carota subsp. sativus] KZM85430.1 hypothetical protein DCAR_027148 [Daucus carota subsp. sativus] KZM99938.1 hypothetical protein DCAR_008693 [Daucus carota subsp. sativus] Length = 135 Score = 80.9 bits (198), Expect = 5e-17 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD +++RDKKVTA KA KA LEERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVTADCLQSRDKKVTAAKATKAKLEERFKTGKNRWFFTKLRF 135 >XP_011095690.1 PREDICTED: 60S ribosomal protein L27-3-like [Sesamum indicum] XP_011095696.1 PREDICTED: 60S ribosomal protein L27-3-like [Sesamum indicum] Length = 135 Score = 80.9 bits (198), Expect = 5e-17 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD + +RDKKVTACK VKA EERFKTGKNRWFF+KLRF Sbjct: 88 DVDLKDVVSADALVSRDKKVTACKEVKAKFEERFKTGKNRWFFSKLRF 135 >XP_006481358.1 PREDICTED: 60S ribosomal protein L27 [Citrus sinensis] Length = 135 Score = 80.9 bits (198), Expect = 5e-17 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD ++++DKKVTACK K LEERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVSADSLQSKDKKVTACKETKKRLEERFKTGKNRWFFTKLRF 135 >KVI09656.1 KOW-like protein [Cynara cardunculus var. scolymus] Length = 135 Score = 80.5 bits (197), Expect = 6e-17 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V D +++RDKKVTACK KA LEERFKTGKNRWFF+KLRF Sbjct: 88 DVDLKDVVSVDALQSRDKKVTACKETKARLEERFKTGKNRWFFSKLRF 135 >XP_011000630.1 PREDICTED: 60S ribosomal protein L27-3-like [Populus euphratica] XP_011000631.1 PREDICTED: 60S ribosomal protein L27-3-like [Populus euphratica] XP_011000632.1 PREDICTED: 60S ribosomal protein L27-3-like [Populus euphratica] Length = 135 Score = 80.5 bits (197), Expect = 6e-17 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD + T+DKKVTACK KA EERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVTADSLTTKDKKVTACKDTKARFEERFKTGKNRWFFTKLRF 135 >ADE76927.1 unknown [Picea sitchensis] Length = 135 Score = 80.5 bits (197), Expect = 6e-17 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V DK+ETRDKKV A K VKAS EERFK GKNRWFFTKLRF Sbjct: 88 DVDLKNVVTFDKLETRDKKVAALKGVKASFEERFKAGKNRWFFTKLRF 135 >KZV50581.1 hypothetical protein F511_33122 [Dorcoceras hygrometricum] Length = 135 Score = 80.1 bits (196), Expect = 9e-17 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD + +RDKKVTACK +KA EERFKTGKNRWFF+KLRF Sbjct: 88 DVDLKDLVTADALASRDKKVTACKGIKAKFEERFKTGKNRWFFSKLRF 135 >ABK93484.1 unknown [Populus trichocarpa] Length = 135 Score = 80.1 bits (196), Expect = 9e-17 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD + T+DKK+TACK KA EERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVTADYLSTKDKKITACKETKARFEERFKTGKNRWFFTKLRF 135 >XP_009609639.1 PREDICTED: 60S ribosomal protein L27 [Nicotiana tomentosiformis] XP_016491570.1 PREDICTED: 60S ribosomal protein L27 [Nicotiana tabacum] Length = 135 Score = 79.7 bits (195), Expect = 1e-16 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD +++RDKKVTA K KA LEERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVNADVLQSRDKKVTAAKEAKARLEERFKTGKNRWFFTKLRF 135 >XP_002300063.1 60S ribosomal protein L27 [Populus trichocarpa] ABK92640.1 unknown [Populus trichocarpa] ABK93497.1 unknown [Populus trichocarpa] ABK94291.1 unknown [Populus trichocarpa] EEE84868.1 60S ribosomal protein L27 [Populus trichocarpa] Length = 135 Score = 79.7 bits (195), Expect = 1e-16 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD + T+DKK+TACK KA EERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVTADCLSTKDKKITACKETKARFEERFKTGKNRWFFTKLRF 135 >OMO95903.1 Ribosomal protein L27e [Corchorus capsularis] OMP07646.1 Ribosomal protein L27e [Corchorus olitorius] Length = 135 Score = 79.3 bits (194), Expect = 2e-16 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD ++T+DKKV ACKA K EERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVTADVLQTKDKKVAACKATKERFEERFKTGKNRWFFTKLRF 135 >XP_016751024.1 PREDICTED: 60S ribosomal protein L27-3-like [Gossypium hirsutum] XP_016751172.1 PREDICTED: 60S ribosomal protein L27-3-like isoform X1 [Gossypium hirsutum] XP_016751173.1 PREDICTED: 60S ribosomal protein L27-3-like isoform X2 [Gossypium hirsutum] XP_017614196.1 PREDICTED: 60S ribosomal protein L27-3-like [Gossypium arboreum] Length = 135 Score = 79.3 bits (194), Expect = 2e-16 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V D ++++DKKV+ACKA K LEERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVTVDSLQSKDKKVSACKATKQKLEERFKTGKNRWFFTKLRF 135 >XP_012849200.1 PREDICTED: 60S ribosomal protein L27-2-like [Erythranthe guttata] Length = 135 Score = 79.3 bits (194), Expect = 2e-16 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD + +RDKKVTACK VK EERFKTGKNRWFF+KLRF Sbjct: 88 DVDLKDVVSADALVSRDKKVTACKEVKGKFEERFKTGKNRWFFSKLRF 135 >XP_012460647.1 PREDICTED: 60S ribosomal protein L27-3-like [Gossypium raimondii] KJB75240.1 hypothetical protein B456_012G033800 [Gossypium raimondii] Length = 135 Score = 79.3 bits (194), Expect = 2e-16 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V D ++++DKKV+ACKA K LEERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVTVDSLQSKDKKVSACKATKQKLEERFKTGKNRWFFTKLRF 135 >XP_012472406.1 PREDICTED: 60S ribosomal protein L27-3-like [Gossypium raimondii] KJB08601.1 hypothetical protein B456_001G092900 [Gossypium raimondii] Length = 135 Score = 79.3 bits (194), Expect = 2e-16 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD ++T+DKKV ACKA K +ERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVNADALQTKDKKVAACKATKERFQERFKTGKNRWFFTKLRF 135 >XP_009395990.1 PREDICTED: 60S ribosomal protein L27-3 [Musa acuminata subsp. malaccensis] Length = 135 Score = 79.3 bits (194), Expect = 2e-16 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK + D +++RDKKVTACK KA LEERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVATLDALQSRDKKVTACKETKARLEERFKTGKNRWFFTKLRF 135 >XP_004241408.1 PREDICTED: 60S ribosomal protein L27 [Solanum lycopersicum] XP_006347291.1 PREDICTED: 60S ribosomal protein L27 [Solanum tuberosum] XP_015079951.1 PREDICTED: 60S ribosomal protein L27 [Solanum pennellii] Length = 135 Score = 79.3 bits (194), Expect = 2e-16 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK +V AD ++ RDKKVTA K KA LEERFKTGKNRWFFTKLRF Sbjct: 88 DVDLKDVVNADVLQARDKKVTAAKETKARLEERFKTGKNRWFFTKLRF 135 >KZV36253.1 hypothetical protein F511_14271 [Dorcoceras hygrometricum] Length = 135 Score = 79.0 bits (193), Expect = 3e-16 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 382 DVDLKTIVGADKMETRDKKVTACKAVKASLEERFKTGKNRWFFTKLRF 239 DVDLK IV AD + +RDKKVTACK +K+ EERFKTGKNRWFF+KLRF Sbjct: 88 DVDLKDIVPADALASRDKKVTACKEIKSRFEERFKTGKNRWFFSKLRF 135