BLASTX nr result
ID: Angelica27_contig00014567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00014567 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM90807.1 hypothetical protein DCAR_021828 [Daucus carota subsp... 156 4e-45 XP_017215009.1 PREDICTED: squalene synthase-like [Daucus carota ... 156 2e-44 ADC32654.1 squalene synthase [Aralia elata] 150 4e-42 AER23670.1 squalene synthase [Eleutherococcus senticosus] 150 4e-42 ABA29019.1 squalene synthase [Panax notoginseng] AGS79226.1 squa... 148 2e-41 ALO18787.1 squalene synthase [Panax notoginseng] 148 2e-41 AIK21786.1 squalene synthase [Panax notoginseng] 148 2e-41 AGI19256.1 squalene synthase [Panax notoginseng] 148 2e-41 AED99863.1 squalene synthase [Panax quinquefolius] 148 2e-41 AJK30630.1 squalene synthase [Panax ginseng] AJK30631.1 squalene... 146 6e-41 AJK30626.1 squalene synthase [Panax ginseng] 146 9e-41 ACA66014.1 squalene synthase [Panax ginseng] 146 1e-40 AJK30635.1 squalene synthase [Panax ginseng] 146 1e-40 AJK30634.1 squalene synthase [Panax ginseng] 146 1e-40 BAA24289.1 squalene synthase [Panax ginseng] BAD08242.1 squalene... 146 1e-40 ACX42425.1 squalene synthase [Bupleurum chinense] 146 1e-40 ACX42423.1 squalene synthase [Bupleurum chinense] 146 1e-40 AAY46017.1 squalene synthase [Bupleurum falcatum] 146 1e-40 ACX42426.1 squalene synthase [Bupleurum chinense] 146 1e-40 AJK30628.1 squalene synthase [Panax ginseng] 146 2e-40 >KZM90807.1 hypothetical protein DCAR_021828 [Daucus carota subsp. sativus] Length = 338 Score = 156 bits (394), Expect = 4e-45 Identities = 77/78 (98%), Positives = 78/78 (100%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTLSLC+NNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN Sbjct: 232 AIGTLSLCYNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 291 Query: 182 ATITLSRLEAIQKTCKDS 235 ATITLSRLEAIQKTCKDS Sbjct: 292 ATITLSRLEAIQKTCKDS 309 >XP_017215009.1 PREDICTED: squalene synthase-like [Daucus carota subsp. sativus] Length = 415 Score = 156 bits (394), Expect = 2e-44 Identities = 77/78 (98%), Positives = 78/78 (100%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTLSLC+NNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN Sbjct: 293 AIGTLSLCYNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 ATITLSRLEAIQKTCKDS Sbjct: 353 ATITLSRLEAIQKTCKDS 370 >ADC32654.1 squalene synthase [Aralia elata] Length = 414 Score = 150 bits (378), Expect = 4e-42 Identities = 74/78 (94%), Positives = 77/78 (98%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >AER23670.1 squalene synthase [Eleutherococcus senticosus] Length = 414 Score = 150 bits (378), Expect = 4e-42 Identities = 74/78 (94%), Positives = 77/78 (98%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >ABA29019.1 squalene synthase [Panax notoginseng] AGS79226.1 squalene synthase [Panax notoginseng] Length = 415 Score = 148 bits (373), Expect = 2e-41 Identities = 73/78 (93%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >ALO18787.1 squalene synthase [Panax notoginseng] Length = 415 Score = 148 bits (373), Expect = 2e-41 Identities = 73/78 (93%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >AIK21786.1 squalene synthase [Panax notoginseng] Length = 415 Score = 148 bits (373), Expect = 2e-41 Identities = 73/78 (93%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >AGI19256.1 squalene synthase [Panax notoginseng] Length = 415 Score = 148 bits (373), Expect = 2e-41 Identities = 73/78 (93%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >AED99863.1 squalene synthase [Panax quinquefolius] Length = 415 Score = 148 bits (373), Expect = 2e-41 Identities = 73/78 (93%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >AJK30630.1 squalene synthase [Panax ginseng] AJK30631.1 squalene synthase [Panax ginseng] Length = 391 Score = 146 bits (369), Expect = 6e-41 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVID+TKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >AJK30626.1 squalene synthase [Panax ginseng] Length = 414 Score = 146 bits (369), Expect = 9e-41 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVID+TKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >ACA66014.1 squalene synthase [Panax ginseng] Length = 415 Score = 146 bits (369), Expect = 1e-40 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVID+TKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >AJK30635.1 squalene synthase [Panax ginseng] Length = 415 Score = 146 bits (369), Expect = 1e-40 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVID+TKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >AJK30634.1 squalene synthase [Panax ginseng] Length = 415 Score = 146 bits (369), Expect = 1e-40 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVID+TKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >BAA24289.1 squalene synthase [Panax ginseng] BAD08242.1 squalene synthase [Panax ginseng] AJV26445.1 squalene synthase [Panax ginseng] Length = 415 Score = 146 bits (369), Expect = 1e-40 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVID+TKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 293 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSKVDNNDPN 352 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 353 ATKTLSRLEAIQKTCKES 370 >ACX42425.1 squalene synthase [Bupleurum chinense] Length = 414 Score = 146 bits (368), Expect = 1e-40 Identities = 71/78 (91%), Positives = 77/78 (98%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTLSLCFNNIQVFRGVVKMRRGLTAK+IDRTKTMSDVYGAFFDFSCLLK+KVD+DDP+ Sbjct: 293 AIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAKVDHDDPS 352 Query: 182 ATITLSRLEAIQKTCKDS 235 A ITLSRLEAIQ+TCK+S Sbjct: 353 AKITLSRLEAIQQTCKNS 370 >ACX42423.1 squalene synthase [Bupleurum chinense] Length = 414 Score = 146 bits (368), Expect = 1e-40 Identities = 71/78 (91%), Positives = 77/78 (98%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTLSLCFNNIQVFRGVVKMRRGLTAK+IDRTKTMSDVYGAFFDFSCLLK+KVD+DDP+ Sbjct: 293 AIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAKVDHDDPS 352 Query: 182 ATITLSRLEAIQKTCKDS 235 A ITLSRLEAIQ+TCK+S Sbjct: 353 AKITLSRLEAIQQTCKNS 370 >AAY46017.1 squalene synthase [Bupleurum falcatum] Length = 415 Score = 146 bits (368), Expect = 1e-40 Identities = 71/78 (91%), Positives = 77/78 (98%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTLSLCFNNIQVFRGVVKMRRGLTAK+IDRTKTMSDVYGAFFDFSCLLK+KVD+DDP+ Sbjct: 293 AIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAKVDHDDPS 352 Query: 182 ATITLSRLEAIQKTCKDS 235 A ITLSRLEAIQ+TCK+S Sbjct: 353 AKITLSRLEAIQQTCKNS 370 >ACX42426.1 squalene synthase [Bupleurum chinense] Length = 415 Score = 146 bits (368), Expect = 1e-40 Identities = 71/78 (91%), Positives = 77/78 (98%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTLSLCFNNIQVFRGVVKMRRGLTAK+IDRTKTMSDVYGAFFDFSCLLK+KVD+DDP+ Sbjct: 293 AIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAKVDHDDPS 352 Query: 182 ATITLSRLEAIQKTCKDS 235 A ITLSRLEAIQ+TCK+S Sbjct: 353 AKITLSRLEAIQQTCKNS 370 >AJK30628.1 squalene synthase [Panax ginseng] Length = 444 Score = 146 bits (369), Expect = 2e-40 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = +2 Query: 2 AIGTLSLCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDNDDPN 181 AIGTL+LCFNN QVFRGVVKMRRGLTAKVID+TKTMSDVYGAFFDFSCLLKSKVDN+DPN Sbjct: 323 AIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSKVDNNDPN 382 Query: 182 ATITLSRLEAIQKTCKDS 235 AT TLSRLEAIQKTCK+S Sbjct: 383 ATKTLSRLEAIQKTCKES 400