BLASTX nr result
ID: Angelica27_contig00014313
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00014313 (233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017223515.1 PREDICTED: U-box domain-containing protein 10-lik... 116 1e-28 XP_017215609.1 PREDICTED: U-box domain-containing protein 11-lik... 84 2e-17 KVI05417.1 Armadillo [Cynara cardunculus var. scolymus] 80 8e-16 KVH96250.1 hypothetical protein Ccrd_001655 [Cynara cardunculus ... 75 6e-14 XP_004238849.1 PREDICTED: U-box domain-containing protein 11 [So... 73 2e-13 XP_015076838.1 PREDICTED: U-box domain-containing protein 11-lik... 72 4e-13 XP_006360416.1 PREDICTED: U-box domain-containing protein 11-lik... 72 7e-13 XP_019164767.1 PREDICTED: U-box domain-containing protein 11-lik... 72 7e-13 XP_009797524.1 PREDICTED: U-box domain-containing protein 11-lik... 70 3e-12 XP_006344225.1 PREDICTED: U-box domain-containing protein 11-lik... 70 3e-12 XP_015073407.1 PREDICTED: U-box domain-containing protein 11-lik... 69 5e-12 XP_004236974.1 PREDICTED: U-box domain-containing protein 11-lik... 69 5e-12 CDP00753.1 unnamed protein product [Coffea canephora] 69 5e-12 XP_017232057.1 PREDICTED: U-box domain-containing protein 10-lik... 69 6e-12 XP_011070638.1 PREDICTED: U-box domain-containing protein 11-lik... 69 9e-12 XP_012846142.1 PREDICTED: U-box domain-containing protein 11 iso... 68 2e-11 XP_012846140.1 PREDICTED: U-box domain-containing protein 11 iso... 68 2e-11 XP_016573028.1 PREDICTED: U-box domain-containing protein 11-lik... 67 3e-11 XP_011075713.1 PREDICTED: U-box domain-containing protein 11-lik... 67 4e-11 XP_010105768.1 U-box domain-containing protein 11 [Morus notabil... 66 6e-11 >XP_017223515.1 PREDICTED: U-box domain-containing protein 10-like [Daucus carota subsp. sativus] KZM85808.1 hypothetical protein DCAR_026770 [Daucus carota subsp. sativus] Length = 656 Score = 116 bits (290), Expect = 1e-28 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGG T F SGDST AS+HAL+GLVQDVG+AS GGFKGPFKKDC+DLARRIALLSHL EE Sbjct: 1 MAGGVTAFSSGDSTSASLHALMGLVQDVGRASCGGFKGPFKKDCSDLARRIALLSHLLEE 60 Query: 21 LRDFKGD 1 +RDFKGD Sbjct: 61 VRDFKGD 67 >XP_017215609.1 PREDICTED: U-box domain-containing protein 11-like [Daucus carota subsp. sativus] KZM86477.1 hypothetical protein DCAR_023611 [Daucus carota subsp. sativus] Length = 637 Score = 84.3 bits (207), Expect = 2e-17 Identities = 40/67 (59%), Positives = 50/67 (74%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGG+ T +T ++ +LL L+QD + S GF GPFKKDC+DLARRIALLSHL EE Sbjct: 1 MAGGDAT-----ATTGAVQSLLSLIQDTNRVSSNGFGGPFKKDCSDLARRIALLSHLLEE 55 Query: 21 LRDFKGD 1 +RDF+GD Sbjct: 56 VRDFEGD 62 >KVI05417.1 Armadillo [Cynara cardunculus var. scolymus] Length = 642 Score = 80.1 bits (196), Expect = 8e-16 Identities = 41/67 (61%), Positives = 51/67 (76%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAG ++T I +A+I +LL LV+DV + S GF G FKKDCTDL+RR+ALLSHL EE Sbjct: 1 MAGVDSTAI-----LAAIQSLLRLVRDVARNSASGFAGEFKKDCTDLSRRVALLSHLLEE 55 Query: 21 LRDFKGD 1 +RDFKGD Sbjct: 56 IRDFKGD 62 >KVH96250.1 hypothetical protein Ccrd_001655 [Cynara cardunculus var. scolymus] Length = 624 Score = 74.7 bits (182), Expect = 6e-14 Identities = 37/67 (55%), Positives = 51/67 (76%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAG ++T I VA+I +LL +++DV ++S GF G FK+DCTDL+RR+ALLSHL EE Sbjct: 1 MAGEDSTAI-----VAAIQSLLRIIRDVARSSATGFTGGFKRDCTDLSRRVALLSHLLEE 55 Query: 21 LRDFKGD 1 +RD +GD Sbjct: 56 IRDSQGD 62 >XP_004238849.1 PREDICTED: U-box domain-containing protein 11 [Solanum lycopersicum] Length = 650 Score = 73.2 bits (178), Expect = 2e-13 Identities = 36/63 (57%), Positives = 47/63 (74%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGGE T ++GD +A+ LL L+ +V + S GF G FKKDCTDLARR+ LL+HLF+E Sbjct: 1 MAGGEATAVAGDHPIAT---LLRLLHEVSQISIAGFYGKFKKDCTDLARRVTLLAHLFDE 57 Query: 21 LRD 13 L+D Sbjct: 58 LKD 60 >XP_015076838.1 PREDICTED: U-box domain-containing protein 11-like [Solanum pennellii] Length = 650 Score = 72.4 bits (176), Expect = 4e-13 Identities = 36/63 (57%), Positives = 46/63 (73%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGGE T ++GD +A+ LL L+ +V + S GF G FKKDCTDLARR+ LL+HLF+E Sbjct: 1 MAGGEATAVAGDHPIAT---LLRLLHEVSQISIAGFYGKFKKDCTDLARRVTLLAHLFDE 57 Query: 21 LRD 13 L D Sbjct: 58 LND 60 >XP_006360416.1 PREDICTED: U-box domain-containing protein 11-like [Solanum tuberosum] Length = 647 Score = 71.6 bits (174), Expect = 7e-13 Identities = 36/63 (57%), Positives = 46/63 (73%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGGE T ++GDST + +V DV + SG GF G FKKDCTDLARR++LL++L EE Sbjct: 1 MAGGEPTAVAGDSTKIPLQ----VVHDVCRISGAGFAGFFKKDCTDLARRVSLLAYLLEE 56 Query: 21 LRD 13 +RD Sbjct: 57 IRD 59 >XP_019164767.1 PREDICTED: U-box domain-containing protein 11-like [Ipomoea nil] Length = 660 Score = 71.6 bits (174), Expect = 7e-13 Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Frame = -3 Query: 201 MAGGET-TFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFE 25 MAGG+T ++G+S ++ A V DV + SG GF G FK+DCTDLARR++LL+HL E Sbjct: 1 MAGGDTIAAVAGESIETALRA----VHDVVRISGSGFSGAFKRDCTDLARRVSLLAHLLE 56 Query: 24 ELRDFK 7 E+RDFK Sbjct: 57 EIRDFK 62 >XP_009797524.1 PREDICTED: U-box domain-containing protein 11-like [Nicotiana sylvestris] Length = 642 Score = 70.1 bits (170), Expect = 3e-12 Identities = 36/63 (57%), Positives = 45/63 (71%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGGE T +GD S+ LL L+ +V + S GF G FKKDCTDLARR+ALL+HL EE Sbjct: 1 MAGGEATAGTGDH---SVDTLLRLIHEVSQISIAGFCGKFKKDCTDLARRVALLAHLLEE 57 Query: 21 LRD 13 ++D Sbjct: 58 IKD 60 >XP_006344225.1 PREDICTED: U-box domain-containing protein 11-like [Solanum tuberosum] Length = 650 Score = 70.1 bits (170), Expect = 3e-12 Identities = 35/63 (55%), Positives = 45/63 (71%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGGE T ++GD +A L L+ +V + S GF G FKKDCTDLARR+ LL+HLF+E Sbjct: 1 MAGGEATAVAGDHPIA---IPLRLLHEVSQISTAGFCGKFKKDCTDLARRVTLLAHLFDE 57 Query: 21 LRD 13 L+D Sbjct: 58 LKD 60 >XP_015073407.1 PREDICTED: U-box domain-containing protein 11-like [Solanum pennellii] Length = 647 Score = 69.3 bits (168), Expect = 5e-12 Identities = 35/63 (55%), Positives = 45/63 (71%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGGE ++GDST + +V DV + SG GF G FKKDCTDLARR++LL++L EE Sbjct: 1 MAGGELIAVAGDSTKIPLQ----VVHDVCRISGAGFAGFFKKDCTDLARRVSLLAYLLEE 56 Query: 21 LRD 13 +RD Sbjct: 57 IRD 59 >XP_004236974.1 PREDICTED: U-box domain-containing protein 11-like [Solanum lycopersicum] Length = 647 Score = 69.3 bits (168), Expect = 5e-12 Identities = 35/63 (55%), Positives = 45/63 (71%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGGE ++GDST + +V DV + SG GF G FKKDCTDLARR++LL++L EE Sbjct: 1 MAGGELIAVAGDSTKIPLQ----VVHDVCRISGAGFAGFFKKDCTDLARRVSLLAYLLEE 56 Query: 21 LRD 13 +RD Sbjct: 57 IRD 59 >CDP00753.1 unnamed protein product [Coffea canephora] Length = 656 Score = 69.3 bits (168), Expect = 5e-12 Identities = 36/67 (53%), Positives = 49/67 (73%), Gaps = 1/67 (1%) Frame = -3 Query: 201 MAGGE-TTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFE 25 MAGG+ TT ++GD + A L LV DV + S GF G F+KDCT+LARR++LL+HL E Sbjct: 1 MAGGDATTAVAGDRP---LQAPLRLVHDVVRISQAGFSGSFQKDCTNLARRVSLLAHLLE 57 Query: 24 ELRDFKG 4 E+++FKG Sbjct: 58 EIKEFKG 64 >XP_017232057.1 PREDICTED: U-box domain-containing protein 10-like [Daucus carota subsp. sativus] KZN06451.1 hypothetical protein DCAR_007288 [Daucus carota subsp. sativus] Length = 617 Score = 68.9 bits (167), Expect = 6e-12 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -3 Query: 144 ALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEELRDFKGD 1 +LL LV+DV + S G+ GPFKKDC DL+RRI LLSHLFEELR F G+ Sbjct: 8 SLLCLVKDVTRISAAGYDGPFKKDCVDLSRRIVLLSHLFEELRHFSGE 55 >XP_011070638.1 PREDICTED: U-box domain-containing protein 11-like [Sesamum indicum] Length = 652 Score = 68.6 bits (166), Expect = 9e-12 Identities = 34/65 (52%), Positives = 43/65 (66%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAGG T I G +T A + L+++V + S GF G FKKDC DL RR+ALL+HL EE Sbjct: 1 MAGGGTAAIEGGATTAPLR----LIREVARISSAGFSGYFKKDCADLGRRVALLAHLLEE 56 Query: 21 LRDFK 7 +RD K Sbjct: 57 IRDSK 61 >XP_012846142.1 PREDICTED: U-box domain-containing protein 11 isoform X2 [Erythranthe guttata] Length = 646 Score = 67.8 bits (164), Expect = 2e-11 Identities = 34/65 (52%), Positives = 43/65 (66%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MA GETT +T A + L++DV + S GF G FKKDC DLARR++LL+HL EE Sbjct: 1 MAAGETTAAEDGATAAPLR----LIRDVARISTAGFSGVFKKDCADLARRVSLLAHLLEE 56 Query: 21 LRDFK 7 +RD K Sbjct: 57 IRDSK 61 >XP_012846140.1 PREDICTED: U-box domain-containing protein 11 isoform X1 [Erythranthe guttata] EYU30050.1 hypothetical protein MIMGU_mgv1a002663mg [Erythranthe guttata] Length = 649 Score = 67.8 bits (164), Expect = 2e-11 Identities = 34/65 (52%), Positives = 43/65 (66%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MA GETT +T A + L++DV + S GF G FKKDC DLARR++LL+HL EE Sbjct: 1 MAAGETTAAEDGATAAPLR----LIRDVARISTAGFSGVFKKDCADLARRVSLLAHLLEE 56 Query: 21 LRDFK 7 +RD K Sbjct: 57 IRDSK 61 >XP_016573028.1 PREDICTED: U-box domain-containing protein 11-like [Capsicum annuum] Length = 650 Score = 67.0 bits (162), Expect = 3e-11 Identities = 33/63 (52%), Positives = 44/63 (69%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MAG + T ++GDST + ++ +V + S GF G FKKDCTDLARRI+LL+HL EE Sbjct: 1 MAGVQPTAVAGDSTKIPLQ----IIHEVSRISSSGFTGIFKKDCTDLARRISLLAHLVEE 56 Query: 21 LRD 13 +RD Sbjct: 57 IRD 59 >XP_011075713.1 PREDICTED: U-box domain-containing protein 11-like [Sesamum indicum] Length = 651 Score = 66.6 bits (161), Expect = 4e-11 Identities = 35/65 (53%), Positives = 44/65 (67%) Frame = -3 Query: 201 MAGGETTFISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEE 22 MA +TT + G T A + LV+DV + S GF G FKKDCTDLARR++LL+HL EE Sbjct: 1 MAAADTTALGGGVTAAPLR----LVRDVVRISIAGFSGFFKKDCTDLARRVSLLAHLLEE 56 Query: 21 LRDFK 7 +RD K Sbjct: 57 IRDSK 61 >XP_010105768.1 U-box domain-containing protein 11 [Morus notabilis] EXC06053.1 U-box domain-containing protein 11 [Morus notabilis] Length = 652 Score = 66.2 bits (160), Expect = 6e-11 Identities = 37/58 (63%), Positives = 41/58 (70%) Frame = -3 Query: 177 ISGDSTVASIHALLGLVQDVGKASGGGFKGPFKKDCTDLARRIALLSHLFEELRDFKG 4 +SGD + LL L DV S GG GPFKKDCTDL RRIALL+HLFEE+RDFKG Sbjct: 5 LSGDGA-DRMPELLKLANDVVAVSIGG--GPFKKDCTDLVRRIALLTHLFEEMRDFKG 59