BLASTX nr result
ID: Angelica27_contig00014032
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00014032 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017252835.1 PREDICTED: probable tyrosine-protein phosphatase ... 76 6e-14 >XP_017252835.1 PREDICTED: probable tyrosine-protein phosphatase At1g05000 [Daucus carota subsp. sativus] KZM96014.1 hypothetical protein DCAR_019256 [Daucus carota subsp. sativus] Length = 225 Score = 76.3 bits (186), Expect = 6e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -2 Query: 495 FMELFDVSTFKHLPITCSFLKSCEGRTHSFPSEDK 391 FMELFDVS FKHLPITCSFLKSCEGRTHSFPSEDK Sbjct: 191 FMELFDVSAFKHLPITCSFLKSCEGRTHSFPSEDK 225