BLASTX nr result
ID: Angelica27_contig00013955
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00013955 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP43283.1 40S ribosomal protein S12, partial [Cajanus cajan] 63 1e-10 XP_010911796.2 PREDICTED: 40S ribosomal protein S12-like, partia... 64 2e-10 EYU21726.1 hypothetical protein MIMGU_mgv1a015907mg [Erythranthe... 63 2e-10 XP_010655009.1 PREDICTED: 40S ribosomal protein S12 [Vitis vinif... 63 4e-10 XP_017254135.1 PREDICTED: 40S ribosomal protein S12-like isoform... 63 5e-10 XP_003611336.1 ribosomal protein L7Ae/L30e/S12e/Gadd45 family pr... 62 6e-10 KRH44544.1 hypothetical protein GLYMA_08G217700 [Glycine max] KR... 62 7e-10 GAV72362.1 Ribosomal_L7Ae domain-containing protein [Cephalotus ... 62 7e-10 XP_006493344.1 PREDICTED: 40S ribosomal protein S12 [Citrus sine... 62 7e-10 XP_006427609.1 hypothetical protein CICLE_v10026727mg [Citrus cl... 62 7e-10 KYP77885.1 40S ribosomal protein S12 [Cajanus cajan] 61 8e-10 KYP44887.1 40S ribosomal protein S12, partial [Cajanus cajan] 61 1e-09 XP_017249862.1 PREDICTED: 40S ribosomal protein S12-like [Daucus... 62 1e-09 CBI38929.3 unnamed protein product, partial [Vitis vinifera] 63 1e-09 CDX96828.1 BnaA08g23710D [Brassica napus] 61 2e-09 CDY70980.1 BnaCnng70680D [Brassica napus] 61 2e-09 XP_010275757.1 PREDICTED: 40S ribosomal protein S12 [Nelumbo nuc... 61 2e-09 XP_002279327.1 PREDICTED: 40S ribosomal protein S12 [Vitis vinif... 61 2e-09 XP_010265631.1 PREDICTED: 40S ribosomal protein S12-like [Nelumb... 61 2e-09 XP_011026209.1 PREDICTED: 40S ribosomal protein S12-like [Populu... 61 2e-09 >KYP43283.1 40S ribosomal protein S12, partial [Cajanus cajan] Length = 100 Score = 63.2 bits (152), Expect = 1e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGVST*H 253 +QPDYVKLVKALCA++NVSL+TV SAKT EWAGVS H Sbjct: 59 DQPDYVKLVKALCAEHNVSLLTVPSAKTLGEWAGVSVIH 97 >XP_010911796.2 PREDICTED: 40S ribosomal protein S12-like, partial [Elaeis guineensis] Length = 121 Score = 63.5 bits (153), Expect = 2e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGVS 262 NQPDYVKLVKALCAD+NV L+TV SAKT EWAGVS Sbjct: 71 NQPDYVKLVKALCADHNVHLVTVPSAKTLGEWAGVS 106 >EYU21726.1 hypothetical protein MIMGU_mgv1a015907mg [Erythranthe guttata] Length = 105 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGVS 262 NQPDYVKLVKALCAD+N +LITV SAKT EWAGVS Sbjct: 67 NQPDYVKLVKALCADHNCNLITVPSAKTLGEWAGVS 102 >XP_010655009.1 PREDICTED: 40S ribosomal protein S12 [Vitis vinifera] Length = 142 Score = 63.2 bits (152), Expect = 4e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+NVSLITV SAKT EWAG+ Sbjct: 68 NQPDYVKLVKALCADHNVSLITVPSAKTLGEWAGL 102 >XP_017254135.1 PREDICTED: 40S ribosomal protein S12-like isoform X1 [Daucus carota subsp. sativus] XP_017254136.1 PREDICTED: 40S ribosomal protein S12-like isoform X2 [Daucus carota subsp. sativus] XP_017254137.1 PREDICTED: 40S ribosomal protein S12-like isoform X1 [Daucus carota subsp. sativus] Length = 145 Score = 62.8 bits (151), Expect = 5e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+NVSL+TV SAKT EWAG+ Sbjct: 71 NQPDYVKLVKALCADHNVSLVTVPSAKTLGEWAGL 105 >XP_003611336.1 ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Medicago truncatula] AES94294.1 ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Medicago truncatula] Length = 107 Score = 61.6 bits (148), Expect = 6e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGVS 262 +QPDYVKLVKALCA++NVSL+TV SAKT EWAGVS Sbjct: 68 DQPDYVKLVKALCAEHNVSLLTVPSAKTLGEWAGVS 103 >KRH44544.1 hypothetical protein GLYMA_08G217700 [Glycine max] KRH44545.1 hypothetical protein GLYMA_08G217700 [Glycine max] Length = 109 Score = 61.6 bits (148), Expect = 7e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGVS 262 +QPDYVKLVKALCA++NVSL+TV SAKT EWAGVS Sbjct: 66 DQPDYVKLVKALCAEHNVSLLTVPSAKTLGEWAGVS 101 >GAV72362.1 Ribosomal_L7Ae domain-containing protein [Cephalotus follicularis] Length = 141 Score = 62.4 bits (150), Expect = 7e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+NVSL+TV SAKT EWAG+ Sbjct: 67 NQPDYVKLVKALCADHNVSLLTVPSAKTLGEWAGL 101 >XP_006493344.1 PREDICTED: 40S ribosomal protein S12 [Citrus sinensis] XP_006493345.1 PREDICTED: 40S ribosomal protein S12 [Citrus sinensis] Length = 141 Score = 62.4 bits (150), Expect = 7e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+NVSL+TV SAKT EWAG+ Sbjct: 67 NQPDYVKLVKALCADHNVSLLTVPSAKTLGEWAGL 101 >XP_006427609.1 hypothetical protein CICLE_v10026727mg [Citrus clementina] XP_006427610.1 hypothetical protein CICLE_v10026727mg [Citrus clementina] ESR40849.1 hypothetical protein CICLE_v10026727mg [Citrus clementina] ESR40850.1 hypothetical protein CICLE_v10026727mg [Citrus clementina] Length = 141 Score = 62.4 bits (150), Expect = 7e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+NVSL+TV SAKT EWAG+ Sbjct: 67 NQPDYVKLVKALCADHNVSLLTVPSAKTLGEWAGL 101 >KYP77885.1 40S ribosomal protein S12 [Cajanus cajan] Length = 87 Score = 60.8 bits (146), Expect = 8e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGVST*H 253 +QPDYVKLVKALCA++NVSL+TV SAKT EWA VS H Sbjct: 46 DQPDYVKLVKALCAEHNVSLLTVPSAKTLGEWASVSVIH 84 >KYP44887.1 40S ribosomal protein S12, partial [Cajanus cajan] Length = 100 Score = 60.8 bits (146), Expect = 1e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGVST*H 253 +QPDYVKLVKALCA++NVSL+TV SAKT EWA VS H Sbjct: 59 DQPDYVKLVKALCAEHNVSLLTVPSAKTLGEWASVSVIH 97 >XP_017249862.1 PREDICTED: 40S ribosomal protein S12-like [Daucus carota subsp. sativus] XP_017249863.1 PREDICTED: 40S ribosomal protein S12-like [Daucus carota subsp. sativus] KZM96138.1 hypothetical protein DCAR_019380 [Daucus carota subsp. sativus] Length = 142 Score = 61.6 bits (148), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+NVSLI+V SAKT EWAG+ Sbjct: 68 NQPDYVKLVKALCADHNVSLISVPSAKTLGEWAGL 102 >CBI38929.3 unnamed protein product, partial [Vitis vinifera] Length = 228 Score = 63.2 bits (152), Expect = 1e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+NVSLITV SAKT EWAG+ Sbjct: 154 NQPDYVKLVKALCADHNVSLITVPSAKTLGEWAGL 188 >CDX96828.1 BnaA08g23710D [Brassica napus] Length = 120 Score = 60.8 bits (146), Expect = 2e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+N++L+TV SAKT EWAG+ Sbjct: 46 NQPDYVKLVKALCADHNINLLTVPSAKTLGEWAGL 80 >CDY70980.1 BnaCnng70680D [Brassica napus] Length = 120 Score = 60.8 bits (146), Expect = 2e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+N++L+TV SAKT EWAG+ Sbjct: 46 NQPDYVKLVKALCADHNINLLTVPSAKTLGEWAGL 80 >XP_010275757.1 PREDICTED: 40S ribosomal protein S12 [Nelumbo nucifera] Length = 138 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDY+KLVKALCAD+NVSLI+V SAKT EWAG+ Sbjct: 64 NQPDYIKLVKALCADHNVSLISVPSAKTLGEWAGL 98 >XP_002279327.1 PREDICTED: 40S ribosomal protein S12 [Vitis vinifera] Length = 140 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDY+KLVKALCAD+NVSLI+V SAKT EWAG+ Sbjct: 66 NQPDYIKLVKALCADHNVSLISVPSAKTLGEWAGL 100 >XP_010265631.1 PREDICTED: 40S ribosomal protein S12-like [Nelumbo nucifera] Length = 143 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDY+KLVKALCAD+NVSLI+V SAKT EWAG+ Sbjct: 69 NQPDYIKLVKALCADHNVSLISVPSAKTLGEWAGL 103 >XP_011026209.1 PREDICTED: 40S ribosomal protein S12-like [Populus euphratica] ABK93056.1 unknown [Populus trichocarpa] Length = 144 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 369 NQPDYVKLVKALCADNNVSLITVSSAKTQREWAGV 265 NQPDYVKLVKALCAD+NV+L+TV SAKT EWAG+ Sbjct: 70 NQPDYVKLVKALCADHNVNLLTVPSAKTLGEWAGL 104