BLASTX nr result
ID: Angelica27_contig00013866
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00013866 (764 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM82927.1 hypothetical protein DCAR_030496 [Daucus carota subsp... 75 5e-12 >KZM82927.1 hypothetical protein DCAR_030496 [Daucus carota subsp. sativus] Length = 375 Score = 75.1 bits (183), Expect = 5e-12 Identities = 34/62 (54%), Positives = 47/62 (75%) Frame = +2 Query: 131 MAQSKSDLEKIGAEGLAMLDEYRHKYQKPKGHVYQGSFPVSVAAQEKKEGFTVDSYQAAR 310 M+Q K +L+ I AEG AML+++ HKYQ+PK HV++ P +VAAQ KKE ++D YQAA+ Sbjct: 1 MSQRKQNLKNIAAEGFAMLEQHVHKYQQPKSHVFEVIIPANVAAQAKKEVVSIDCYQAAQ 60 Query: 311 MY 316 MY Sbjct: 61 MY 62