BLASTX nr result
ID: Angelica27_contig00013839
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00013839 (493 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM86080.1 hypothetical protein DCAR_026498 [Daucus carota subsp... 63 2e-08 >KZM86080.1 hypothetical protein DCAR_026498 [Daucus carota subsp. sativus] Length = 1309 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 455 LEGVVAPGIMDKTVSEMAYSVEKIIKQLQPEMIDLQHIIDK 333 LEGV AP IMDKTVS+MAYS+EKI KQL+ EMI+L+HI+DK Sbjct: 1055 LEGVGAPLIMDKTVSQMAYSLEKISKQLELEMIELKHIVDK 1095